KEGG   Alkaliphilus oremlandii: Clos_1844Help
Entry
Clos_1844         CDS       T00607                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aoe  Alkaliphilus oremlandii
Brite
Enzymes [BR:aoe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Clos_1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABW19384
UniProt: A8MHV2
LinkDB All DBs
Position
1948318..1948731
Genome map
AA seq 137 aa AA seqDB search
MNYYQYDNDIPYNFNGYTVNDWPADIHPLENCCSIPHFMELAVAHINGGPLAPDIKGTVY
FIKAAGGTNVYIDVSGLPPYTPAIGNNNPIGPLGFHMHQNCSCAVGDPADPFQSAGGHWN
PTNQPHGSVYSLVVLYV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaattattatcaatacgataacgatattccttacaactttaatggttacactgtaaat
gattggccagcagatatacatccattagaaaattgttgctctattcctcatttcatggag
ttggctgtagcgcatatcaatggaggaccccttgcgcctgatattaaaggaacggtttat
tttataaaagcggcaggaggtaccaatgtatatattgatgtttcaggtcttccgccatat
acaccagccataggtaataataatccgattggtcctcttgggtttcatatgcatcaaaat
tgctcttgcgcagtaggtgatccagcagatcctttccaaagtgccggtggacattggaat
ccgacgaatcagcctcatggtagtgtatactcattggtggttttgtatgtttag

DBGET integrated database retrieval system