KEGG   Asparagus officinalis (garden asparagus): 109819605Help
Entry
109819605         CDS       T05243                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aof00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109819605
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109819605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 109819605
NCBI-ProteinID: XP_020240973
LinkDB All DBs
Position
8
AA seq 151 aa AA seqDB search
MVKAVAVVAGDVVKGHVFFSQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGP
HFNPAGKEHGAPEDENRHAGDLGNVTVAEDGTATFSITDSQIPLTGPNSIIGRAVVVHAD
PDDLGKGGHELSKSTGNAGGRVGCGIIGLQA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgctgtagttgctggtgatgtcgtgaagggccatgttttcttcagc
caagagggagatggcccaactacagtaaccggaagtgtctctggtctgaaacccgggctt
catggtttccatgttcatgctcttggtgacaccacaaatgggtgcatgtccactggacct
catttcaatcctgctggaaaggaacatggggcacctgaagatgagaatcgccatgctggt
gaccttggaaatgtgactgttgctgaggatgggaccgctactttcagtattactgacagt
cagattccactcactgggccgaattccattattggaagagctgttgttgtccatgctgac
cctgatgatcttggaaagggtggacacgagcttagcaaaagcactggaaatgctggcgga
agagttggctgtggtatcatcggacttcaggcttga

DBGET integrated database retrieval system