KEGG   Asparagus officinalis (garden asparagus): 109819615Help
Entry
109819615         CDS       T05243                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109819615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aof03036]
    109819615
Enzymes [BR:aof01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109819615
Chromosome and associated proteins [BR:aof03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109819615
   Polycomb group proteins
    PRC2-EZH2 complex
     109819615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 109819615
NCBI-ProteinID: XP_020240981
LinkDB All DBs
Position
8
AA seq 914 aa AA seqDB search
MATASRRQISGGDNIIGAKEGSCASPYVLKIIDSLKDQVVVDRCSYVKRKVEENKQKLSA
ITDHAHHLSTIRRNVTMGSTVSGADLLTRRQEDALGMLTGVDLSCGEKDDNSCQEESSNA
SSPVLFGNNIIGKNATRPIKLSEVSKLPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDQSC
GEALICSDSEEDIVDDEEEKKEFGKVEDYILRMTIQEAGLSDDVLDTLAQCLGKSPCEIK
ARYEHFLMREKPENCKEKQEGELDVKVYDGFLDKDLDASLDSFDNLFCRRCLVFDCRLHG
CSQDLVFPVEKQHPLSSSDEGAPCGIHCYRLIAKSESMATVNSQTSHVFEELTPSSSSAG
VRHSPRKKSNGGSVGRRRCNQSESASSNARVVSESSESEVHPNHDGASANISSSPSKSKL
GVKSGIRKKSNKRVAERVLICMRKRQKKTAQSESDSIASGSLGPKDLKLRSNTHNDSNDT
SSSSRNKILKKATFRKSGRKSPLQKNFSSPPVDVHNGSEDEMSKETSTADDDDCSRKEFV
DENIYKPENGCKSWKIIEKSLFAKGLEIFGRNSCLIARNLLSGMKTCADVFQYMNFIENK
GSCRAADGSNSLCEGHTKGKDRSRSRFMRRRGRVRRLKYTWKSAGYHSIRKRITDRKDQP
CKQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKICKNRFRGCHCAKSQCRSRQCPCFAA
DRECDPDICRNCWIGCGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFL
KNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFAN
HSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEAPGSKKD
GTTFPSVGRAKKIA
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggccacggcgagtcgccgtcaaatctccggcggcgataatattattggagcgaaagaa
ggaagctgtgcttctccatatgttttaaaaattattgattccttgaaggaccaagtcgtc
gttgatcgttgttcctatgttaagagaaaagtggaagagaacaagcagaaactgagtgct
atcacagatcatgcccatcatttgtcaacaattaggaggaatgttacaatgggtagtact
gtatcaggtgcagatttgttgactagaaggcaagaggatgcactaggtatgctgactggt
gttgatttgtcttgtggagaaaaggatgacaattcttgccaagaagaaagttcaaatgct
tcatctcctgttttgtttgggaacaatattattggaaagaatgccactcgtccaatcaaa
ctgtctgaagtttctaaactacctccatacactacgtggatatttttggacagaaatcaa
aggatggcagaagatcagtctgttgttggtcgaagaagaatctattatgaccaaagttgt
ggcgaagctttaatttgtagtgatagtgaggaagatatagttgatgatgaagaagaaaag
aaagaatttggaaaagttgaagattatattcttcgaatgactatacaagaggctggtttg
tctgatgatgtgttggatacattggctcagtgccttgggaagagtccttgtgaaattaag
gcaagatatgaacattttcttatgagggagaaacctgaaaattgcaaagaaaagcaagaa
ggtgaattggatgtgaaagtttatgatggatttctggataaagatctggacgcatcattg
gattcttttgacaaccttttttgtcgacgatgtctggttttcgattgcagattacatggg
tgttctcaggatttagttttccctgtggaaaaacaacatcctttgagcagctcagatgaa
ggggcaccttgtggtattcattgctacaggctgattgctaaatcagaaagcatggctaca
gtgaattctcagacatctcatgtttttgaagaactaactccttcctccagtagtgctggt
gtccgtcattctcccagaaagaaatccaatggcggttctgttggcaggaggagatgtaat
caaagtgaaagtgcatcttccaatgctagagttgtatcagaaagcagcgagtcagaagta
catccaaaccatgatggtgcttctgctaatatttcttcatcaccctcaaaaagtaagctt
ggagtgaaaagtgggattcgaaagaaaagcaacaaaagagtagctgaacgtgttcttatt
tgcatgcgtaaaagacaaaagaaaactgcacagtcagagtcagattccattgcaagtgga
tcccttgggcccaaagatttgaaacttagatcgaatacacacaatgatagcaatgatact
agttcatcttcgaggaacaaaatccttaaaaaagcaacatttaggaagtcaggaagaaag
agtcctctgcagaagaatttcagttcaccaccagttgatgttcataatggatctgaagat
gagatgtccaaggaaacttcaactgcagatgacgatgactgttcaaggaaagagtttgtt
gatgagaacatctacaaacctgaaaatggttgtaaatcctggaaaattatcgagaagagc
ctgtttgcaaaaggtttagagatttttggaaggaatagctgtttgattgcaagaaatctt
ttgagtgggatgaaaacatgtgcagatgtattccaatacatgaatttcattgaaaacaaa
ggatcatgtagagctgccgacggttcaaattctctctgtgaaggtcataccaagggtaag
gatagatcgaggtcaaggtttatgaggaggcgaggtagagttcgtcgtttaaagtacaca
tggaagtcggctggttatcattccatcagaaagaggattactgatagaaaggatcaaccc
tgtaagcaatataatccttgtggttgtcagactgcttgtgggaaacaatgtccttgcctt
ttaaatggaacttgctgtgagaaatactgcgggtgtcccaagatatgcaagaatcggttt
cgagggtgtcattgtgcaaagagccaatgtcgaagtcgtcaatgcccatgttttgctgct
gatagagaatgtgatcctgatatttgcagaaattgctggattgggtgtggtgatggtagt
ttaggtgtacctagtcaaagaggagataattatgaatgcaggaacatgaagcttctcctg
aaacaacagcaaagggttttacttgggagatctgatgtttcgggttggggtgctttcctc
aagaatagcgttggaaaacacgaataccttggggagtacaccggggagttaatctctcat
agagaagcggataaacgcgggaagatatatgaccgtgaaaattcatcttttcttttcaac
ctcaatgaccagtttgttctggatgcttatcggaaaggtgacaagttgaagtttgccaac
cattcccctgatccgaactgctatgcaaaggttataatggtagcaggggatcatagagtt
ggtatatttgcaaaagagcgaataagtgcaggagaggagctcttctatgactatcgctat
gagccagatcgagctcctgcttgggcgagaaaacctgaagctcctggctccaagaaggat
ggcacaactttcccttcagttggccgagcgaaaaagattgcttga

DBGET integrated database retrieval system