KEGG   Asparagus officinalis (garden asparagus): 109819765Help
Entry
109819765         CDS       T05243                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00052  Galactose metabolism
aof00500  Starch and sucrose metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109819765
   00500 Starch and sucrose metabolism
    109819765
Enzymes [BR:aof01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109819765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 CBM60 DUF4770
Motif
Other DBs
NCBI-GeneID: 109819765
NCBI-ProteinID: XP_020241232
LinkDB All DBs
Position
8
AA seq 883 aa AA seqDB search
MGKAQRLMSMMKASLLFYLFFLCSYFYFNSSSCYQENEQIVGYGYELGSVYSDPSGKLLN
AELKLIKNSSVYGPDIQNLNLFASFETENRLRIKITDANNRRYEIPQDIIPRQNPSKPTW
SPLQKNTIANSNFILTLHSIYRFGFSIARRSTGELLFDASPKKSEPGIVFKDQYLEITSN
LPSTSFLYGLGEHTKKNFRLVPNDTLTLWNADIGASTIDQNLYGSHPFYIDIRSNGSTHG
VLLMNSNGMDVVYGGSFISYKIIGGVLDFYFFAGPSPKDVIEQYTELIGRPAPMPYWSFG
YHQCRWGYKNVEDLEGVVEGYAKAGIPLEVMWTDIDYMDAFKDFTLDPINFPVDKMNAFV
DRLHKNGQKYVVIIDPGINVNKSYATFTRGMKADIFLKRNSSNYLGEVWPGPVYFPDFFN
PDAVNFWDQEIEIFHKTLPIDGLWIDMNEISNFITPSPLNSLDDPPYKINNAGVQRPINN
LTVPASSIHYGNLTEYNVHNLHGLLESRATHDALIKLRGKRPFVLTRSTFVGSGKYAAHW
TGDNAATWDDLGYSIPTILNFGLFGIPMVGADICGFSGNTTEELCRRWIQLGAFYPFARN
HATKGSIRHELYLWESVARSAKKALGLRYRLLPYFYTLMYEARTKGTPIARPLFFSDPED
TQTYDISAQFMIGGAVMVSPVLSPGVNSVTAYFPKGIWFNLFNYSSTMITDSGEYFTLEA
PENSVNVHVRGGNILPMQEEAMTTQLARDNGFELLVVLHEGMAEGEVFVDDGEVVEMGGK
ESEWSTIKFSAEVEGKDVKIKSVLVNGTYALDHKLVVKKVLVLGLRFEEGIEMHSLYVNG
VELGGKGVGLSYEKRGSFGVAEIDGLTQLIGNDFELSLKFSVY
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagctcaaaggctaatgagcatgatgaaggcttcacttttattctaccttttc
ttcctctgctcgtatttctatttcaattcttcctcttgttatcaagagaatgaacaaatc
gtaggatacggatatgaactaggatcagtctactcggatccctctggaaaattgctgaat
gcagagctcaagctgataaaaaattcatcggtctacggacccgatatccaaaatctcaat
ctctttgcaagctttgaaactgagaatcgactgcgaataaaaataacagacgcaaataat
cgaagatatgaaatcccacaggacataattccccgccaaaatcctagcaaacccacctgg
tctcctctacagaaaaataccatcgctaactcaaacttcattctcacacttcactcaatc
taccgctttggcttctccattgctcggcgctccaccggtgaacttctcttcgacgcaagc
cctaaaaaatccgaacccggcatcgtattcaaagaccaatacttagaaatcacatcaaac
ttaccatcaacttcattcctttatggccttggagaacatactaagaaaaattttcgattg
gtacccaacgacacattaacactatggaatgcggatatcggagcttcaactatcgatcag
aacttatacgggtctcacccgttttatattgatataaggtctaacggatcaactcatggt
gttctgttgatgaatagtaatggtatggatgttgtctatggagggtcttttattagttac
aagattattggaggagttttggatttctatttcttcgctggaccgagtccaaaggatgta
atcgagcaatatactgagctaattggaaggccagctccaatgccatattggtcattcggg
tatcatcagtgtcgatgggggtacaagaatgttgaagatctagaaggagttgtcgaagga
tatgcaaaagctggaattcctctagaagttatgtggactgatattgattacatggatgca
ttcaaggattttacacttgatcccatcaatttccctgttgacaagatgaatgccttcgtt
gatcgactccataaaaatgggcagaaatatgtcgttataatagacccaggtatcaatgtt
aacaaaagctatgcgacattcacaagaggaatgaaagcagacatctttctaaagagaaac
agcagcaattaccttggagaagtttggccaggtccagtctacttcccagacttcttcaat
cctgacgctgtaaacttctgggaccaagaaatcgaaatctttcacaaaactcttcccatc
gatggcctttggatcgacatgaatgagatctccaacttcatcactccctctcctctcaac
tccctcgacgaccctccatacaaaatcaacaacgctggagttcagcggcctattaacaat
cttacagtccctgcatcgagcattcactatgggaacttgactgagtacaatgtacataac
ctgcatgggcttttggaatcgagagcaactcatgatgctttgattaaacttaggggcaag
cgcccgtttgtgcttacgaggtccacgtttgttggttcggggaagtatgctgcacattgg
actggtgataatgcagcaacatgggatgatttggggtactcgataccgactattttgaac
tttggtctgtttgggattcctatggttggagctgatatatgtgggttttcaggtaatact
actgaggagctttgccgaaggtggattcagcttggtgcgttctacccttttgctcgaaat
cacgcgacaaaaggttcgataagacacgagctctatctttgggagtcggtcgctagatca
gcaaagaaggcgctaggattgcgttatcgcctgctcccctacttctacacgctaatgtac
gaggcgcgtactaagggtactccaattgccaggccgcttttcttctcagaccctgaggac
acgcaaacttacgatattagcgcacagtttatgatcggaggtgcagtaatggtatctcca
gtcctaagtccaggagtaaattcagtaactgcttatttcccgaaaggcatttggttcaat
ctcttcaattactcaagtacaatgattactgattctggggaatattttacgctagaagcg
cctgaaaatagtgtaaatgttcatgtacgaggaggtaatatattaccgatgcaggaggag
gcgatgactacacaattagctagagataacgggttcgagcttctggttgtgctacatgaa
ggtatggctgaaggtgaggtgtttgtagatgatggagaggttgtggagatgggaggaaag
gagagtgaatggagtacaattaagttttcggcggaagttgaaggcaaagatgtgaagatc
aagtcggtgctagttaatggtacatacgctttggatcataagttggtagtgaagaaggtt
ctggtgcttgggcttaggtttgaagaaggtatagagatgcatagcttgtatgtgaatgga
gttgaattgggagggaaaggggtgggtttgagttatgagaagcgagggagttttggcgtg
gcagaaattgacggcttgacccagcttattggaaatgactttgagttgagtttgaagttc
agtgtatactaa

DBGET integrated database retrieval system