KEGG   Asparagus officinalis (garden asparagus): 109824566Help
Entry
109824566         CDS       T05243                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof03030  DNA replication
aof03410  Base excision repair
aof03420  Nucleotide excision repair
aof03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aof00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109824566
   03410 Base excision repair
    109824566
   03420 Nucleotide excision repair
    109824566
   03430 Mismatch repair
    109824566
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aof03032]
    109824566
   03400 DNA repair and recombination proteins [BR:aof03400]
    109824566
Enzymes [BR:aof01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109824566
    6.5.1.6  DNA ligase (ATP or NAD+)
     109824566
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109824566
DNA replication proteins [BR:aof03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109824566
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109824566
DNA repair and recombination proteins [BR:aof03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109824566
   NER (nucleotide excision repair)
    Other NER factors
     109824566
   MMR (mismatch excision repair)
    Other MMR factors
     109824566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 109824566
NCBI-ProteinID: XP_020246783
LinkDB All DBs
Position
9
AA seq 1407 aa AA seqDB search
MATLPSSSSSSSTKILTLNSSSLFLSSFNSLLNSSPQVLIPHSFRLLSQNYSLPPIPSDL
PQTKLIPATKFIIDGFKSAGDFSVSYFLSHFHSDHYTGLTPNWSKGIIFCSEVTSKLLIR
TLNISPLFVVSLALNATVEIDGCEVAVVDANHCPGAVQFLFSVRGEDGRKLERYVHTGDF
RFCDSMKKDPILSQFVGSDAVFLDATYCNPKFVFPSQEESIDYIVRLIKRIREESEALKE
PVLILIATYVIGKERILLEISRQLKCLLHVDRRKMSILSVLGLGDSNVFTEDASASSIHV
IGWNLLGETWPYFRPNFVKMKEIMLERGYSKAVGFVSTGWLYETKKDGFAVRVKDELEIH
LVPYSEHSSYDELREFVRFLRPKRVIPTVGDDADKIDGKSARALQKHFQGLVDETANKQE
FLMAFNKKAVNADVMAGYDNPVNVCRSEDVAEEDSLSQKEALSEDFNSEDMEEEIQEIRD
SLPSWVTQDQIISLLRSSNGEVVEAVSEFFEHEIEFYEKANVCILAATDPVSQTSSLPPT
APGSQAISHNDFTSFPETKCFPGSQENGSKFVKLGKKPISKNLAAPKSVLPKKRGSRIGN
KPKKKGKTSSALELSGSKQPTITKFFGKVISNSTVIAAQESIGGTSLIVDTVEKHKKELN
QFLQIIDNGIERSTAASLMEKVKGNVGEAVDVYYSICSSVFGDEEILMPCNHKDHMTAAV
SNNCTEEASCSPHGTDNIPSLFVRVTSGDDSSVINISLPIDKYSPVEHACWEAGKPAPYL
HLARTFDLVEREKGKIKTTAMLCNMFRSLLALSPNDVLPAVYLCTNKIAPDHENVELNVG
SGLVIAALEEACGINKSRIKEMYTSFGDLGDVAQECRQTQALLAPPRPLSIRNLFCTLKK
ISPETGNGSAVRKKNLVVRIMRSCREMEMKFVVRTLVRNLRIGAMMKTILPALGQAVVLN
SYSTAHHIGSSRSLKSGLQVISEEVTEAYNVIPNLDLLIPSLMSKGINFSGSSLEMVPGT
PIPPMLARITNGTLHVLTSFQNRAFTCEYKYDGQRAQIHRLADGSIRIFSRQMKDSTSRF
PDLINIIKELSNPAFTTFILDTEVVAVDRKGGVKLLSFQDLSSRERGRKDSSITIVILQV
DICVFIFDVMFSNGKRLLDLPLRERRTCLKDLFHKVKPGFLEFAKEITVEADEAYLSNES
TVTNINTFFEDACKSSCEGIMAKTLDIDAGYCASKRTDAWLKVKRDYIEELGDSLDLVPI
GAWYGNGRKAGWYSPFLMACYNPDAEEFQSVCRVMSGFSDEFYKSMKEFFSGEKILSRKP
PYYQTDESPDLWFSAEVVWEIRGADFTISPVHHSAVGLIHPSRGISVRLPRFVRPVSDRK
PEDCTTAADIACMFNSQTRKMYVGTEH
NT seq 4224 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctcccatcctcctcctcctcctcctccaccaaaatcctaaccctaaattcc
tcctcattattcctttcctccttcaattccctcctcaattcatcccctcaagtcctaatc
ccccattccttcagactcctctctcaaaactactctcttccccctattccgtccgatctc
ccccaaactaaactcatccccgccaccaaattcatcattgacggctttaaatctgccggc
gatttctccgtttcttacttcctctcccacttccattccgatcactacactgggttaacc
cctaactggtcgaaaggcatcatattttgctctgaggtaacttctaagctcttgattcga
accctaaacatctcccccttgttcgtcgtttcgcttgcccttaatgcgacggtggagatt
gacggatgcgaggttgcggttgttgatgccaatcactgccccggtgctgtacagttcttg
ttcagtgttcgtggtgaagatggacggaaattggagaggtatgttcatactggggacttc
cgattttgtgattcgatgaagaaagatccgattttgagccagtttgttggttctgatgct
gttttcttggacgctacttattgtaaccccaagtttgttttcccgtcgcaagaggagtcg
atagattatattgtgaggctgatcaagagaattagggaggaaagtgaggcgttgaaggag
cctgtgctgattcttattgctacttacgtgatcgggaaggagagaatattgctagagatt
tcacggcagttgaaatgtctactgcatgtggatagaagaaagatgtcaatattgtctgtt
ttaggacttggggatagtaatgtttttaccgaggatgcgtcggctagtagtattcatgtg
atcggttggaatttgttgggtgaaacttggccgtatttccgccctaattttgttaaaatg
aaggagataatgttggagagaggatattcgaaggcggttggttttgtttcaactggatgg
ctgtacgaaacaaagaaagatggctttgcagtgagggttaaggatgaacttgagatccat
cttgttccttatagtgaacattcgagctatgatgaactcagagagtttgtgaggttcttg
aggccaaagcgtgtgattccaactgttggagatgatgctgacaaaattgatggcaagagt
gcgagggctttgcagaaacattttcaggggttagttgatgaaactgcaaataagcaagaa
tttttgatggctttcaataagaaggcagtaaatgctgatgtgatggctggatatgataac
cccgttaatgtatgtcggtcagaggatgtggcggaggaggatagtttaagccagaaagaa
gccctttctgaagacttcaactctgaggacatggaggaagaaattcaggagatccgtgac
agcttgccatcatgggttactcaagatcagattattagtctgttaagaagctccaacgga
gaagttgtggaagctgtttcagagttcttcgaacatgagattgagttctatgagaaagca
aatgtttgcatccttgcagctactgatcctgtctctcagacaagctcccttccacctact
gctcctggctctcaggcaatctcacacaatgattttacttcttttcctgaaacaaaatgt
ttcccagggagccaggagaatggtagtaagtttgtaaagttaggtaagaaaccaataagc
aaaaatcttgcagcgccaaaatctgttttgcctaagaaaaggggttcacgcattggaaac
aaaccgaagaaaaaaggaaaaacttcttcagctttagagttgagtggatcaaagcaacct
acaatcacaaagttctttggaaaagttatatccaattccacagttattgcagctcaggag
tcgattggtgggacttctttgatagttgacactgttgaaaagcacaaaaaagagttgaat
cagtttcttcagataatagataatggtattgaaaggagcactgcggcctctttaatggag
aaggtgaagggaaatgttggtgaagcagttgatgtatactatagtatttgtagcagtgtg
ttcggagatgaggagatattaatgccttgcaatcacaaagatcatatgactgctgctgtt
agtaataattgtactgaagaagcaagttgttctcctcatggaacagacaacataccgagt
ttatttgtacgtgtaacttcaggagatgactcaagtgtgattaatatatcattaccaatt
gataagtactctcccgttgaacatgcgtgttgggaggctggaaaacctgctccctatttg
caccttgcacggacgtttgatttggtagagagagaaaaaggcaagataaaaaccactgcc
atgctttgcaacatgttcagaagtttgcttgccttgtcacctaatgacgtgttgcctgct
gtttatctttgcacaaacaaaattgctcctgatcatgaaaatgtggaattgaatgttggc
agcggtttggtcatagctgcattggaagaggcatgtggcattaacaagtcgagaatcaaa
gaaatgtatacttcttttggtgatcttggtgatgttgcacaagaatgccgacagacacaa
gcattgcttgctcctcctcgaccactgtctattcgtaatttattttgcacccttaagaag
ataagtcctgaaacaggtaatggaagtgctgtaagaaagaaaaatcttgttgtacgtatt
atgcgttcttgcagagaaatggaaatgaagtttgttgttcgcactttggtccggaatctg
cgtattggggccatgatgaagaccattctaccagcactgggccaagctgtggtgttgaac
agctactctactgctcatcatattggatcttctcgaagtctaaagtcagggcttcaggtc
atttcagaagaagttactgaggcttataatgtaattccaaatttggacctacttattcct
tctcttatgagtaaaggcatcaacttttctggatcaagtttagaaatggttccaggaaca
cctattccaccaatgcttgctagaattacaaatgggaccctccacgtactaacatcattt
caaaacagagcttttacttgtgaatataaatatgatggtcagcgtgctcaaatccacaga
cttgctgatgggtctatacgaattttttcacggcaaatgaaagattcaacgtctagattt
ccagatttgataaacattattaaagaattatctaaccctgcatttacaacattcatattg
gatacagaggtcgtagcagttgacaggaagggtggagtcaagcttttgtctttccaagat
ctatcttctcgggagagaggaaggaaagattcgtcaatcacaatcgtgatcttgcaggtt
gacatttgtgtcttcatctttgatgtcatgttttcaaatggaaagaggttgttggatttg
ccacttcgtgaaaggaggacatgtctaaaagacttgtttcacaaggtcaagcctggtttc
ttggaatttgcgaaggaaataacagtggaagcagatgaagcatatttgagtaatgaaagc
acagtaaccaatataaacaccttttttgaagatgcctgtaaatcgtcatgtgaaggaata
atggcaaaaactctagatattgatgctggatattgtgcatcaaagcgcactgatgcctgg
ttaaaggtcaaacgtgactatattgaagaattgggtgacagtcttgatttggtacccatt
ggcgcttggtatgggaatggaagaaaagcaggatggtacagccctttccttatggcgtgc
tacaaccctgatgctgaagagtttcaaagtgtgtgtagagtcatgtctggcttctcagat
gaattctataagtcgatgaaagaattcttttctggagagaaaatattgtcaagaaagcct
ccatactaccaaactgatgagtcaccagatctctggttttctgcagaagtggtctgggaa
attagaggcgcagattttacaatctccccggttcatcattctgctgtaggcttgatccac
ccatctcggggcatctcggtgaggctgccgaggtttgttcgtcctgtatcggacaggaag
ccagaggattgcactacagcagctgacattgcttgtatgttcaactcccagactagaaaa
atgtatgtgggaacagaacactga

DBGET integrated database retrieval system