KEGG   Asparagus officinalis (garden asparagus): 109828255Help
Entry
109828255         CDS       T05243                                 

Definition
(RefSeq) hexokinase-2, chloroplastic isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00010  Glycolysis / Gluconeogenesis
aof00051  Fructose and mannose metabolism
aof00052  Galactose metabolism
aof00500  Starch and sucrose metabolism
aof00520  Amino sugar and nucleotide sugar metabolism
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
aof01200  Carbon metabolism
Module
aof_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aof_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109828255
   00051 Fructose and mannose metabolism
    109828255
   00052 Galactose metabolism
    109828255
   00500 Starch and sucrose metabolism
    109828255
   00520 Amino sugar and nucleotide sugar metabolism
    109828255
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109828255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aof04131]
    109828255
Enzymes [BR:aof01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109828255
Membrane trafficking [BR:aof04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109828255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 109828255
NCBI-ProteinID: XP_020250874
LinkDB All DBs
Position
Unknown
AA seq 428 aa AA seqDB search
MRAGLVADGGSDLKMILSYVDSLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESRVVDTE
FEQVAIPQELMHSTTEELFDFIASELARFAAKESARFRWPQGRKGEIGFTFSFPVRQTSI
DSGIFIKWTKGFAVSGTAGKDVVECLKEAMKRQGLDMRVSALVNDAVGTLAGAHYWDEDV
VVAVILGTGTNACYIERMDAIAKMGKLADGSGKTIINTEWGAFSTGLPLTVFDRDMDSES
INPGEQIFEKTISGMYLGEIVRRVLLKMAKASALFGYPVPDKLSTPFVLRTPDLCAMQQD
DSKDLKEVETILSNTIGATYSTLGARKIVVEVCDTIVKRGGRLAGAGIVGILQKMERDSK
GLVFGKRTVVAMDGGLYEHYPQYRNYLKEAVTELLGFEISRNVIIEHTKDGSGIGAALLA
ASNSKHVS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagggcggggctggtcgctgatggcgggagtgatctcaagatgatcctgagttacgtc
gattctcttcccactggggatgaaaagggtctgttttacgcgttggatcttggtggaaca
aatttccgggtgctgagggtgcaattgggaggaaaggagagccgagtggtcgatactgaa
ttcgagcaagttgcaattcctcaggagctcatgcatagtactacggaggagttgtttgat
tttattgcttctgagttagcaaggtttgcagcgaaggagagtgcgaggtttcgctggcct
caagggaggaaaggagagattggttttacattttcttttcctgtgaggcagacttcaatt
gactcaggcatttttatcaagtggacaaagggttttgctgtctctgggacagcaggaaag
gacgtcgttgaatgcttaaaagaagcaatgaaaagacagggtttagatatgcgggtatca
gccttggtgaatgatgcagttggaacactagctggagctcactactgggatgaagatgtg
gtggttgcggtaattctgggtactggtaccaatgcatgctatattgagaggatggatgcc
attgctaaaatggggaaacttgccgatgggtcaggaaaaacgattatcaacactgaatgg
ggggcattctcaactggtcttcctttgactgtttttgatagagatatggattctgaaagc
attaatcctggagagcagatatttgagaaaacaatctctggaatgtacctaggtgaaatt
gtaagaagagtgctgcttaagatggcaaaagcatcagctttgtttggatatcctgtgcct
gacaagctatccactccttttgtgctcaggactcctgatctttgcgccatgcagcaggat
gattccaaggatctgaaagaagtcgagacaatattgagcaacaccattggtgcaacatac
tctaccttaggagccagaaaaatcgtggtggaggtctgtgacaccattgtgaagcgaggt
ggaagattggcaggagcagggattgtgggaattctgcaaaaaatggagcgagattccaaa
ggcctcgtctttggaaagagaacggtggttgccatggatggtggcctttatgagcattat
cctcagtatcgaaactatctcaaggaagctgttacagagttacttggtttcgagatttcg
agaaatgtgataattgaacacacaaaagatggttctggcattggagcagctcttttagcc
gcttctaattcaaagcatgtatcttag

DBGET integrated database retrieval system