KEGG   Asparagus officinalis (garden asparagus): 109831167Help
Entry
109831167         CDS       T05243                                 

Definition
(RefSeq) NADP-dependent malic enzyme-like
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00620  Pyruvate metabolism
aof00710  Carbon fixation in photosynthetic organisms
aof01100  Metabolic pathways
aof01200  Carbon metabolism
Module
aof_M00169  CAM (Crassulacean acid metabolism), light
aof_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109831167
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109831167
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     109831167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: malic Malic_M
Motif
Other DBs
NCBI-GeneID: 109831167
NCBI-ProteinID: XP_020254095
LinkDB All DBs
Position
2
AA seq 244 aa AA seqDB search
MYMLRSPIERMLVEELNEVTSIAHDTLRSTTEQGARNTSWNLRMVEEAILRLLIVLAVTM
EELAHGGTKFLHFSEMTICAELVTSVSLKYSVMDEGMGIPVGKLSLYTALGGIRPNTCLP
ITIDVGTNNKQLLNDEFYIGLRHKLATCQEYAELLHEFMTAVKQNYEDKVLIQFEDFSNH
NAFELLAKYSTSYLLFNDDIQGTASIVLAGLVPALNLVGEKLPEHTFWFLGAGKSGTEKL
NLQD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtacatgctgaggagtccaattgagagaatgttggtagaagaactcaatgaggtgact
tctattgcacatgataccttaagatcgactaccgagcaaggagcaaggaatacatcgtgg
aacttgcgcatggtggaagaggccattcttcgtcttttgatcgtcctcgcagttacaatg
gaggaacttgcgcatggtggtaccaagttcctacatttttctgaaatgaccatatgcgcc
gagctggtgacgtctgtttctctgaagtattccgtgatggacgagggtatgggaattcct
gttggcaagctttctttgtacacagcccttggagggattcgaccaaatacttgcttaccc
atcacgattgatgtgggcacgaacaataagcaattgttgaatgatgagttctatattggg
ttgcggcacaagcttgctacttgtcaggaatatgctgaattactacatgaattcatgact
gctgtcaaacagaactatgaggataaagtacttattcagtttgaggatttttcaaaccat
aatgcatttgaattgcttgcaaaatatagcacaagttatcttctctttaatgatgatatt
cagggaacagcttctattgtcctggctgggcttgttccagcactaaacttggttggtgaa
aaattaccggaacacactttttggtttcttggtgctggcaagtctgggacagagaaattg
aatctccaggattaa

DBGET integrated database retrieval system