KEGG   Asparagus officinalis (garden asparagus): 109833558Help
Entry
109833558         CDS       T05243                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00250  Alanine, aspartate and glutamate metabolism
aof00410  beta-Alanine metabolism
aof00430  Taurine and hypotaurine metabolism
aof00650  Butanoate metabolism
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
Module
aof_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109833558
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109833558
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109833558
   00430 Taurine and hypotaurine metabolism
    109833558
Enzymes [BR:aof01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109833558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DUF2250
Motif
Other DBs
NCBI-GeneID: 109833558
NCBI-ProteinID: XP_020256866
LinkDB All DBs
Position
3
AA seq 496 aa AA seqDB search
MALSKTTSESDISIHSTFASRYVRAALPRFRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRRWQNKRRAEGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVDTVDENTICVAAILGSTLNGEFEDVKLLNDLLIEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
VFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMENCQENAMVLKQGLEK
TGRFNIVSKDNAVPLVAFSLKDRTRHNEFEVSDHLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVLDIEKVLHELDTLPSKLLMTSEEKKVMRNTNGVVKKNALETQRSVT
EAWKKFVLSKKTNGVC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggctctctccaaaactacttctgaatccgatatatcgatccactccactttcgcttca
agatacgttcgggccgctctcccaaggtttcggatgccggagaattcgataccgaaggag
gcagcgtatcagataatcaacgatgagctgatgctcgatggaaatccgaggctgaacctg
gcttcgtttgtgactacatggatggagccagagtgtgataagcttattatggctgcgatt
aacaagaattatgtcgatatggatgaataccccgttaccactgagcttcagaatcgatgc
gtgaatatgattgcccatctcttcaatgctccgcttggtgactcggaaactgcggtagga
gttggaacagtgggctcctctgaggccattatgcttgctgggctagcattcaagaggagg
tggcagaacaaacgcagggccgagggaaagccttgtgacaagcccaacattgtcaccgga
gcaaatgtccaagtttgctgggagaagtttgcgaggtactttgaagttgagctgaaggaa
gtgaagctaagagatgggtactatgttatggaccctgaaaaggctgtggacacggtagac
gagaacactatttgtgtggctgcgatcttgggttcgacacttaatggagaatttgaggat
gtcaagctcctgaacgacctcttgattgagaagaacaaagaaacagggtgggatacacca
attcacgtagacgcagcaagtggtggatttattgccccgttcctgtacccggagctagaa
tgggacttccgacttcctctagtgaagagcatcaacgttagcggccacaaatatggccta
gtgtatgcaggcattgggtgggtcatttggaggagcaaagaggacttgcctgaggaactc
gttttccatattaattatctcggagctgatcaacctactttcactctcaatttctccaaa
ggttctagtcagattatcgcgcaatactatcagttaattcgcttggggttcgagggatac
aagaacataatggagaactgccaagaaaacgcaatggtcctaaaacaaggcctcgaaaaa
accggtagattcaatatcgtttccaaggacaatgccgtccccttagttgcattctcgctc
aaagatcgaaccagacacaatgagtttgaagtgtcagaccacctgagacgtttcggttgg
atcgtgccagcttacacaatgccacccgatgcacaacacatcacagtcttacgagtcgtt
attagagaggatttcagtcgaacgctcgctgagaggctcgttcttgatatagagaaggtt
cttcatgagctcgatacattgccttcaaagttgcttatgactagtgaagagaagaaggtg
atgaggaatactaatggggttgttaagaagaatgcacttgagactcagaggtcggtgacg
gaggcttggaagaagtttgttttgagtaagaagaccaatggagtttgttaa

DBGET integrated database retrieval system