KEGG   Asparagus officinalis (garden asparagus): 109835310Help
Entry
109835310         CDS       T05243                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00061  Fatty acid biosynthesis
aof00780  Biotin metabolism
aof01100  Metabolic pathways
aof01212  Fatty acid metabolism
Module
aof_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109835310
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    109835310
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    109835310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aof01004]
    109835310
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     109835310
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     109835310
Lipid biosynthesis proteins [BR:aof01004]
 Fatty acid synthase
  Component type
   109835310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 109835310
NCBI-ProteinID: XP_020258897
LinkDB All DBs
Position
1
AA seq 377 aa AA seqDB search
MAAMAGASLQMAATRQCVGYPQRMSRLETRGLAQTKLGCSSCVSSAQPLQLSFAPAALRL
SHVVTRAMASESQRNGPPGLPIDLRGKRAFIAGVADDNGYGWAIAKALAAAGAEILVGTW
VPALNIFETSLRRGKFDESRLLPDGSLMEITKVYPLDAVYDTPEDVPEDVKTNKRYAGAS
NWTVKEVAESVKNDFGTIDILVHSLANGPEVTKPLLETSRKGYLASISASSYSFVSLLQH
FLPIMNPGGASISLTYIASERTIPGYGGGMSSAKAALESDTRVLAFEAGRKGKIRVNTIS
AGPLGSRAAKAIGFIEKMINYSYTNAPLQKELSADEVGSTAAFLVSPLASAVTGSVVYVD
NGLNTMGLASDSPSLSL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaatggccggtgctagtctgcaaatggcagctaccaggcagtgcgtcggttat
cctcagagaatgtcgagattggagacaagaggattagcccaaactaaacttggatgctca
tcctgtgtttcttctgctcaacctcttcagctgagctttgcgcctgctgctttgaggctg
agccatgttgttacgagggctatggctagtgagagccaaagaaatggtcctccgggattg
cccattgatttgagaggtaaaagggcattcattgctggagtagctgacgacaatggctat
gggtgggcaattgctaaagctcttgctgctgcaggtgctgagattcttgttggtacatgg
gtgcctgcactgaacatttttgagactagcttaagacgtgggaaatttgatgagtcacgc
cttttaccagatggttctcttatggaaatcaccaaagtgtaccctttagatgcagtgtat
gatactccagaggatgttcctgaagatgtgaaaacaaataaaagatatgcaggtgcctct
aactggactgtgaaggaagtagctgaatctgtcaagaatgattttggaaccattgatatt
ctcgtgcattcccttgccaatggaccagaggttacaaaacctctcctggaaacatcaaga
aagggatatcttgcttcaatatctgcttcaagttactcttttgtgtcccttctgcagcac
tttcttcctatcatgaatccaggaggtgcatccatctctttgacatatattgcttctgaa
agaaccattcctggttatggtggaggcatgagctcagcaaaagcggccctggagagtgac
accagagtgctagcttttgaagctgggaggaaaggaaaaattagggttaacacgatttct
gcaggtccactaggtagtagggccgcaaaagccattggattcatcgagaagatgataaat
tactcctacactaatgcaccattgcagaaagaactgtcagcagatgaagttgggagcaca
gcagcattcttggtgtcaccattggcttcagctgtaactggctctgtagtctatgtggac
aatgggctgaacaccatgggccttgcttctgacagcccttcgctttccttatag

DBGET integrated database retrieval system