KEGG   Asparagus officinalis (garden asparagus): 109836512Help
Entry
109836512         CDS       T05243                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aof00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109836512
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109836512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 109836512
NCBI-ProteinID: XP_020260009
LinkDB All DBs
Position
4
AA seq 224 aa AA seqDB search
MIAASMAAQLISSSSKTLTLISPPPLSSSSSLARPFRSSFSFGKPLNFSASNLSIAAAAA
ASKPLTVVAASKKAVAVLKGNSEVEGVVTLLQEDDGPTTVKVRVTGLTPGLHGFHLHEFG
DTTNGCISTGPHFNPNGMTHGAPEDEIRHAGDLGNIVANADGVAETTIVDKQVPLAGPNA
VIGRAFVVHELEDDLGKGGHELSLSTGNAGGRLACGVVGLTPVE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagcttcaatggctgctcaactgatctcctcctcctccaaaaccctaacccta
atttctcctcctcctctttcttcttcttcttcccttgctcgccctttccgctcctctttc
tccttcggcaagcccctcaatttctccgcttccaatctctccatcgccgccgccgccgcc
gcttcaaaacccttgaccgtcgtcgccgcctctaagaaggccgttgccgtactcaaggga
aactccgaggtcgagggcgtcgtcactctccttcaagaagacgatggtccgacaacagtg
aaagttcgtgttactggacttacaccaggacttcatgggttccatcttcatgagtttggt
gataccaccaatggctgcatatctacagggccgcatttcaacccaaatgggatgacacat
ggtgctcctgaagatgaaatccgtcatgcgggtgacctggggaacattgttgcaaatgct
gatggagtggccgagacaacaattgtggataagcaggttccattggctggccctaatgca
gtcattggaagagcatttgtagttcatgagcttgaggatgacctggggaaaggaggacat
gagcttagccttagcactgggaacgcagggggaagattagcatgtggtgttgttggattg
actccagttgaatga

DBGET integrated database retrieval system