KEGG   Asparagus officinalis (garden asparagus): 109837183Help
Entry
109837183         CDS       T05243                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00564  Glycerophospholipid metabolism
aof01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109837183
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     109837183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO_C DAO
Motif
Other DBs
NCBI-GeneID: 109837183
NCBI-ProteinID: XP_020260906
LinkDB All DBs
Position
4
AA seq 467 aa AA seqDB search
MTPCFEWFEVLYYWAGLKMYDLVAGRRMLHLSRYYSADESIELFPTLARKGHDRSLKGTV
VYYDGQMNDSRLNVGLACTAALVGAAVLNHAEVISIIKDDAGDRIIGARIRDKISGKEFD
TFARVVVNAAGPFCDAVRKMADKDAPPMISPSSGVHIVLPDYYSPEGMGLIVPKTKDGRV
VFMLPWLGRTIAGTTDSNTPITMLPEPHEDEIQFILDAICDYLNVQVRRGDVLSAWSGIR
PLAIDPSAKNTESISRDHVVCEDYPGLVTITGGKWTTYRSMAEDAVNAAVRSGKLKPANG
CVTNNLHIVGGNGWDPASFTVLAQQYVRMKKSYGGKIIPGVMDSYISKHLSHAYGTMAER
VATIAQNENLGKRLAHGYPFLEAEVAYCARNEYCESAVDFVARRCRLAFLDTDAAGRALP
RIIEILASEHKWDKARKKLEFQKAKQFLETFKSSKNAQFHDGKHTGS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacaccatgctttgagtggtttgaagttctttattactgggcgggcctaaaaatgtac
gatcttgttgctggtcgaagaatgctgcatttatctagatactattctgcagatgaatcg
attgaacttttccctactctggcgagaaaaggtcatgacagaagtttgaaaggaacagtg
gtttattatgatgggcagatgaacgattctcggctgaatgtaggattagcttgcactgct
gccttagttggtgctgcggtgcttaaccatgcagaagttatttccattataaaagatgat
gctggtgatcggataattggtgcacgtatccgagataagatatcaggcaaagagtttgat
acatttgcaagagttgttgtaaatgcggccgggccattttgcgatgctgtacgaaaaatg
gctgacaaagatgctccacctatgatttctccaagtagcggtgtgcacattgtgcttcct
gattattactcccctgagggaatgggactaattgtaccaaaaacaaaagatggccgtgtt
gtattcatgctgccctggttaggaagaacaattgcagggactacagattctaatactccc
attactatgcttccggaaccacatgaagatgaaatacaatttatattggatgccatctgt
gattaccttaatgttcaggtacgacgtggagatgtactttcagcttggagtggtatccgc
cctttggcaatagatccatcagcaaagaacactgagagtatttctagagaccatgttgtg
tgcgaagattatcctggtctagtaacaattactggtggaaaatggacaacttacagaagc
atggctgaagatgcggtgaatgcagctgtaaggtcaggaaagttgaagccggctaatggt
tgtgtgactaacaacctgcatattgttgggggaaacggttgggaccctgcatccttcact
gtactcgcacagcaatatgtacgcatgaagaaatcatatggtggaaaaattattcctgga
gttatggacagttatatttctaagcatttgtcacatgcatatggtacgatggctgaaaga
gtggcaaccatagctcagaatgagaaccttgggaagcggcttgctcatggataccctttt
ctagaggctgaggttgcatactgtgctcggaatgaatattgtgaatctgctgttgacttt
gttgccaggagatgtaggcttgctttcctggacactgatgccgctggcagagcattgcca
cgaattattgagatactggcttctgagcacaagtgggataaggcgaggaaaaaacttgag
ttccaaaaggccaaacaatttttagaaaccttcaaatcatctaaaaatgcacagtttcac
gatggaaaacatacagggtcatga

DBGET integrated database retrieval system