KEGG   Asparagus officinalis (garden asparagus): 109837445Help
Entry
109837445         CDS       T05243                                 

Definition
(RefSeq) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00220  Arginine biosynthesis
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
aof01210  2-Oxocarboxylic acid metabolism
aof01230  Biosynthesis of amino acids
Module
aof_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109837445
Enzymes [BR:aof01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     109837445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M20_dimer Peptidase_M20
Motif
Other DBs
NCBI-GeneID: 109837445
NCBI-ProteinID: XP_020261285
LinkDB All DBs
Position
4
AA seq 299 aa AA seqDB search
MRRLGETKPALKSTVVAVFIANEENSSVLGIGVDALVKDELLDKLKNGPLFWIDTADKQP
CIGTGGMIAWRLRATGKLFHSGLAHKAINPLEMAMEALKEIQLRFYRDFPPHPQEQVYGF
ATPSTMKPTQWSYPGGGVNQIPAECTVSGDVRLTPFYSTKDVVKKLQEYVDDINANIDKL
PTQGPVSKYVLPDENLTGRLSISFDESIMTGVACNLDSRGFHVLCKATELVVGHVKPYSI
TGSLPLIRELQDEGFDVQTSGYGLMATYHAKNEYCLFSDMCQGFQVFVSIIAQLEEDSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggttgggggagacaaagccagctctaaaaagcacagtagtggctgtgtttatt
gcaaatgaagagaattcatctgtacttgggattggggttgatgcgcttgttaaggatgag
cttcttgataagctgaagaacggacctttgttttggattgatactgcagacaaacaacca
tgtatagggactggaggcatgatagcatggagacttcgagctacagggaagcttttccac
agtggtcttgctcacaaagctatcaaccctttggagatggcaatggaagcacttaaggag
atacaactgcgtttctatagggacttccctccacatccacaagaacaggtctatggcttt
gccaccccatcaactatgaaacctactcagtggagttatccaggaggaggggtcaaccag
attccagctgaatgcacggtgtcaggggatgtaaggttaactcccttttatagcacaaaa
gatgtggttaagaagttgcaagaatatgtagatgacataaatgctaatatagataaacta
cccactcaagggccagtgtcaaaatatgtccttccggatgaaaatttgacgggaaggctt
tcaatcagttttgacgagtctataatgacgggagttgcttgtaatcttgattctcggggc
ttccatgtgttgtgcaaagcaacagagttagtggttggccatgtgaagccttactccata
actggaagtttgccactgattcgagaattgcaggatgaaggttttgatgttcaaacttct
ggatatgggctaatggctacataccatgcgaagaatgagtactgcctgttttctgatatg
tgccaaggcttccaagtgttcgtgagcatcatcgctcaactggaagaggacagtagctga

DBGET integrated database retrieval system