KEGG   Asparagus officinalis (garden asparagus): 109839875Help
Entry
109839875         CDS       T05243                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00620  Pyruvate metabolism
aof00710  Carbon fixation in photosynthetic organisms
aof01100  Metabolic pathways
aof01200  Carbon metabolism
Module
aof_M00168  CAM (Crassulacean acid metabolism), dark
aof_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
aof_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
aof_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109839875
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109839875
Enzymes [BR:aof01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109839875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109839875
NCBI-ProteinID: XP_020263913
LinkDB All DBs
Position
5
AA seq 966 aa AA seqDB search
MSRGEKLEKLTSIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQE
CYELSAEYEGKHDLKKLDELGNMLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRI
KLKKGDFVDEASATTESDIEETLKRLVVQLKKSPVEVFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRAPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
KDVCMLARMMAANLYFSQIEDLMFELSMWRCSDELRVQADILHRTSKKDAKHYIEFWKQI
PSNEPYRIILGYVRDKLYYTHERSRHLLSNGYSEIPEEATFTNIEQFLEPLELCYRSLCT
CGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITRHLEIGSYREWSEEK
RQEWLLAELSGKRPLFGPDLPKTEEIADVLETFHVIADLPSDCFGAYIISMATAPSDVLA
VELLQRECHVKKPLRVVPLFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSDSG
KDAGRLSAAWALYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDEMAVVAT
KEYRSIVFQEPRFVEYFRLATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKYVMEKDSKNLHTLQAMYNEWPFFRVTIDLIEMVFAKGDPGIASVYD
KLLVSKDLWPLGERLRANYGETKNLLLKVAGHRDLLEGDPYLKQRLRLRDSYITTLNVCQ
AYTLKRIRDPDYHVKLRPHLSKDVMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaggggagaagttggagaagttaacgtcgatcgatgcgcagttgaggcttttg
gcgccggggaaagtatcggaggatgacaaattggtggagtacgatgctctgctcttggat
cggttcctcgacattctacaggatttgcacggcgaagatattagagagacggttcaagag
tgttatgagttatcagctgagtacgagggaaagcatgacctgaagaagctggatgaactg
gggaatatgctgacaagtttggatccaggggattccattgtggttgccagttcattctcg
cacatgctcaacttggcaaacttagctgaggaggtccaaattgcatacaggaggaggatt
aaattgaagaagggagatttcgttgatgaggcttctgccactaccgaatcagacattgag
gagaccctcaaaaggcttgttgtgcagctgaaaaaatctcctgtagaggtttttgatgct
ctgaagaatcaaacagtcgatctagttcttactgctcatccaactcagtcagttaggagg
tcgctgcttcagaagcacggaaggataaggaattgcttagcgcagctttatgcgaaagat
attacgcctgatgataagcaggagcttgatgaagcactccagagagagattcaagctgcc
ttcagaactgatgagatccggagagctcctcccactccacaagatgaaatgagggcagga
atgagttacttccatgaaactatatggaagggtgttcctaagtttttacggcgtgttgac
acggctctgaaaaacatcgggatcaatgagcgtgttccctataatgctcctcttattcaa
ttttcttcatggatggggggtgaccgtgatggaaatcctagagtaactccagaggttaca
aaggatgtatgcatgttagcgagaatgatggctgcaaacttatacttttcccagattgag
gatttaatgtttgagctgtctatgtggcgctgcagtgatgagcttcgagttcaagcggat
attttacatcgtacttcaaagaaggatgcaaaacattatatagagttttggaaacaaatt
ccttcaaatgaaccttaccgcattatacttgggtatgtgagagataagctatattatact
catgaacgttcaaggcatttattgtcaaatgggtactctgaaattcctgaggaagcaact
ttcaccaacatcgagcagttccttgaaccccttgagctctgttaccgatcgctttgcact
tgtggtgataggcccatagctgatggaagccttcttgactttttgcggcaagtatcaacc
tttggcttgtctcttgtgagactcgatatcaggcaagaatctgataggcacactgatgtc
atggatgccatcactaggcatctagaaattggatcctaccgtgagtggtctgaggagaag
cgtcaagaatggctgttagctgaacttagtggaaaacgtcctttatttggtcctgatctt
cccaaaactgaagaaattgctgatgttttagaaacatttcatgtcattgctgatctgcct
tctgattgctttggcgcgtatatcatctcaatggcaactgcaccatctgatgttcttgct
gttgaactcttgcagcgagaatgccatgttaagaaaccactgagagttgtgcctctattt
gagaaacttgcagatcttgaggcagcccctgcagccgtggctagactcttctcaatagac
tggtacaaaaacaggattaatggaaaacaagaagtaatgattggatactcggattctggt
aaggatgctgggcgactttctgcagcttgggcattatataaagctcaggaagagctaata
aaggttgccaagcaatatggtgtaaagttgacaatgttccatgggcgaggtggtactgtt
gggagaggaggtggtccgacccatcttgctatattatctcagccaccagacacaatccat
ggatcacttcgagttacagttcaaggtgaagtcattgaacagtcttttggtgaagagcat
ttgtgtttcagaacgctccaaaggttcacagctgctactcttgagcatgggatgcaccca
ccgatttctcccaagccagaatggcgtgctctgatggatgagatggctgttgtggccaca
aaggaatatcgatcaattgtctttcaggaaccacgcttcgttgagtacttccgcctggca
acacctgaaacggagtatggtcggatgaacattggcagtcggccttcaaagaggaaaccc
agtggaggcatagagtctttacgtgcaatcccatggatttttgcatggactcagacaagg
tttcaccttcctgtgtggcttggcttcggtgcagcattcaagtatgtcatggaaaaggat
agcaagaacctgcataccttgcaagctatgtacaatgagtggccattcttcagggtaacc
attgacctgattgagatggttttcgcaaagggagatccaggcattgcttctgtatatgat
aaacttctcgtttcgaaagatttatggccgcttggtgagcgattgagagccaattacgga
gagacaaagaatcttcttctaaaggttgcgggtcacagagatcttcttgaaggagatcca
tacttgaagcagaggcttcgccttcgagattcttacataacaactctaaacgtttgccaa
gcctacactctgaagagaatcagagatcctgattatcatgtaaaactgaggcctcacttg
tccaaggatgtcatggaatctagcaaaccagctgcagaattggtgaagctgaacccaact
agcgagtatgctccaggtttagaagacacattgattcttactatgaaggggatagctgcg
ggtatgcagaacaccggttag

DBGET integrated database retrieval system