KEGG   Asparagus officinalis (garden asparagus): 109840303Help
Entry
109840303         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00010  Glycolysis / Gluconeogenesis
aof00053  Ascorbate and aldarate metabolism
aof00071  Fatty acid degradation
aof00280  Valine, leucine and isoleucine degradation
aof00310  Lysine degradation
aof00330  Arginine and proline metabolism
aof00340  Histidine metabolism
aof00380  Tryptophan metabolism
aof00410  beta-Alanine metabolism
aof00561  Glycerolipid metabolism
aof00620  Pyruvate metabolism
aof00903  Limonene and pinene degradation
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109840303
   00053 Ascorbate and aldarate metabolism
    109840303
   00620 Pyruvate metabolism
    109840303
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109840303
   00561 Glycerolipid metabolism
    109840303
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109840303
   00310 Lysine degradation
    109840303
   00330 Arginine and proline metabolism
    109840303
   00340 Histidine metabolism
    109840303
   00380 Tryptophan metabolism
    109840303
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109840303
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    109840303
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109840303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 109840303
NCBI-ProteinID: XP_020264472
LinkDB All DBs
Position
5
AA seq 534 aa AA seqDB search
MAAARRITSSIISRCLSASPRSILLRGGASSGIQRYGTAAAVDEQPITPPVKVEYTKLLI
NGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDVNHAVAAARNAFDEGPWPKMPAYERS
RILLRFADLIEKHNDEIAALETWDNGKPYEQAAQVEIPMLTRFMRYYAGWADKIHGLVVP
ADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLSALYVA
KLLHEAGIPEGVLNIVSGFGPTAGAALASHMEVDKLAFTGSTDTGKIVLEMAAKSNLKPV
TLELGGKSPMIVLDDADVDKAVELAHSALFFNQGQCCCAGSRTFVHESIYDEFVEKSKAR
ALKRVVGDPFRKGVEQGPQIDDEQFNKILRCIRSGVDSGANLVTXRYGSKGFYIQPTIFS
DVQDDMAIAKEEIFGPVQSILKFRDLDEVIKRANTTRYGLAAGVFTSNLDNANTLIRALK
VGTVWVNCFDVFDAAIPFGGFKMSGQGREKGIDGLKAYLQVKAVVTPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgctcgtaggatcacttccagtattatctctcgctgcttatccgcttctcct
cgttctattctcctcagaggaggtgcctcatccggaattcaaaggtatggcactgctgct
gcagttgacgagcaaccgatcacaccacccgtcaaagtagagtacacaaagcttttaata
aatggaaattttgtggattcggcttcaggaaagacttttccgaccttggatcctagaacc
ggggaagttattgctcatgttgcagaaggagatgctgaagatgtcaaccatgctgttgct
gctgctcgcaacgcattcgatgaaggaccctggccaaagatgcccgcttatgaaaggtca
cgcatattgctaaggtttgcggatttgattgagaagcacaatgatgaaattgcagcgcta
gaaacttgggacaacgggaagccttatgaacaggctgcccaggtcgaaattcctatgcta
acacgtttcatgcgctattatgctggttgggcggacaagatacatgggcttgttgtcccg
gctgatggtccccatcatgtacaagttcttcatgagccgattggtgttgctggtcagatc
attccatggaatttcccactccttatgtttgcttggaaggttggaccagcactagcatgt
ggaaacacaattgtacttaagactgcagaacagacgcctttgtctgctttatatgttgcg
aagttattgcatgaggcagggattcctgaaggtgttttgaacattgtctctggttttggt
cctactgctggtgcagctcttgccagtcacatggaagtcgataagcttgcttttactgga
tcaactgatactggcaagatcgtacttgaaatggctgcgaaaagcaaccttaagcctgtg
acgctggagcttggaggcaagtctccgatgatcgtgttggatgatgctgatgttgataag
gcggtagagcttgcacatagtgcattgttcttcaatcagggacaatgctgctgtgctggg
tctcgtacttttgtacatgaaagcatttatgatgagtttgtggaaaaatcgaaagctcgt
gctctgaaacgtgttgttggtgaccctttcagaaagggcgtggagcaaggtcctcagatt
gatgatgagcaatttaataagatccttcgctgcataaggtcaggtgtggatagcggtgct
aaccttgtgacnnntagatatggcagcaagggcttctacattcaacccaccattttctcc
gatgtccaggatgatatggccattgccaaggaagagatctttggaccagtgcagagcatc
ctaaaatttagagacctcgatgaagtgataaagagagctaataccactcgctacggccta
gctgctggagttttcacaagcaaccttgacaacgctaacactctaatccgagcattgaag
gttggtaccgtgtgggttaactgcttcgatgtttttgatgcagcaattcctttcggggga
ttcaagatgagtggccaaggaagagagaagggcattgacggccttaaggcctacttgcag
gttaaggcagttgttactcctctcaagaatcctgcttggttgtag

DBGET integrated database retrieval system