KEGG   Asparagus officinalis (garden asparagus): 109840441Help
Entry
109840441         CDS       T05243                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00630  Glyoxylate and dicarboxylate metabolism
aof00710  Carbon fixation in photosynthetic organisms
aof01100  Metabolic pathways
aof01200  Carbon metabolism
Module
aof_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aof_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
aof_M00532  Photorespiration
aof_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109840441
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109840441
Enzymes [BR:aof01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     109840441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 109840441
NCBI-ProteinID: XP_020264680
LinkDB All DBs
Position
5
AA seq 172 aa AA seqDB search
MSSAGSLSATKVAGCTGLRADAGRHLFPAKSSVGWRARTVSNGSRVHCMKTWNPINNKKF
ETLSYLPPLSPESIAKQVEYMVGKGWVPCLEFDEVGAVHRTNSQMPGYYDGRYWTLWKLP
MFGCTDSSQVLNEIEECKKTYPNAYIRLLSFDNKHHCQRMSFVIQKPSPVNA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagctggatctctctctgcaactaaggttgccggatgcaccggcctgagagcc
gacgcaggccgacacctttttccggcgaagagcagcgttgggtggcgtgcaagaactgtt
tccaatggctccagggttcactgcatgaagacttggaatccaattaacaacaagaagttt
gagactctctcttatctgccacctctgtctccagaatccatagcaaagcaggttgagtac
atggtcggtaaaggatgggtgccttgcttggagtttgatgaggttggagcagtgcacaga
accaacagtcagatgccaggctactacgacggcaggtactggactctgtggaagctcccc
atgtttggctgcaccgactcctcccaagtactgaacgagatcgaggagtgcaagaaaacc
tacccaaatgcttacatccgtctcctctccttcgacaacaagcatcactgccagcgcatg
tccttcgtcatccaaaagccctcgcccgtcaacgcctga

DBGET integrated database retrieval system