KEGG   Asparagus officinalis (garden asparagus): 109843887Help
Entry
109843887         CDS       T05243                                 

Definition
(RefSeq) uncharacterized protein LOC109843887
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00630  Glyoxylate and dicarboxylate metabolism
aof00710  Carbon fixation in photosynthetic organisms
aof01100  Metabolic pathways
aof01200  Carbon metabolism
Module
aof_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aof_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
aof_M00532  Photorespiration
aof_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:aof00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109843887
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109843887
Enzymes [BR:aof01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     109843887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 109843887
NCBI-ProteinID: XP_020268437
LinkDB All DBs
Position
5
AA seq 487 aa AA seqDB search
MSCREGLMSPQTETKASVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVTAQPGVPPEEA
GAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVIGEAEQFIAYVAYPLDLFEEGSV
TNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCT
IKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFCFCAEALYKAQAETG
EIKGHYLNATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHI
HRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDY
IEKDRSRGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGN
APGAVANRVALEACVQARNEGRDLAREGNEIIREAAKWSPELAAACEVWKEIKFEFEPVD
KIDKQKV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtagggagggacttatgtcaccacaaacagagactaaagcaagtgttggattt
aaagctggtgttaaagattacagattgacttattatactcctgattacgaaaccaaagat
actgatatcttggcagcattccgagtaactgctcaacccggagttccccctgaagaagcg
ggcgctgcggtagctgccgaatcttctactggtacatggacaactgtgtggactgatgga
cttaccagtcttgatcgttacaaaggacgatgctaccacatcgagcccgttattggggaa
gcagagcaatttattgcttatgtagcttatcctttagacctttttgaagaaggttctgtt
actaacatgtttacttccattgtgggtaatgtatttggtttcaaagccctacgagctcta
cgtttggaggatctgcgaattccccctgcttattccaaaactttccaaggcccgcctcat
ggtatccaagttgaaagagataaattgaacaagtatggtcgtcccctattgggatgtact
attaaaccaaaattgggattatccgcaaaaaactacggtagagcagtttatgaatgttta
cgcggtgggcttgattttaccaaggatgatgaaaacgtgaactcacaaccttttatgcgt
tggcgagaccgtttctgtttttgtgctgaagctctttataaagcacaagcggaaacaggt
gaaatcaaaggacattacttgaatgcaactgcaggtacatgtgaagaaatgatgaaaagg
gccatatttgccagagaattgggagttcccatcgtaatgcatgactacttaactggagga
tttactgcaaataccactttggctcattattgccgcgacaatggtctacttcttcacatc
caccgcgcaatgcatgcagttattgatagacagaaaaatcatggtatgcattttcgtgta
ctagctaaagcattacgtatgtctggtggagatcatattcacgctggtacagtagtaggt
aaactggaaggggaacgtgagatgactttaggttttgttgatttattacgtgatgattat
attgaaaaagaccgaagtcgcggtatttttttcactcaagattgggtttctatgccaggt
gttattcccgtggcttcagggggtattcatgtttggcatatgcctgccctaaccgaaatc
tttggagatgattccgtactacagttcggtggaggaactttaggacacccttggggaaat
gcacctggtgcggtagctaatcgggtagctttagaagcatgcgtacaagctcgtaatgag
ggacgtgatcttgctcgtgagggtaatgagattatccgtgaagctgccaaatggagcccg
gaactagccgctgcttgtgaagtatggaaagagatcaaattcgagttcgaaccagtagat
aagatagataaacagaaagtataa

DBGET integrated database retrieval system