KEGG   Asparagus officinalis (garden asparagus): 109844811Help
Entry
109844811         CDS       T05243                                 

Definition
(RefSeq) alpha-amylase isozyme 3C isoform X1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00500  Starch and sucrose metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109844811
Enzymes [BR:aof01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     109844811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amyl_C2 Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 109844811
NCBI-ProteinID: XP_020269550
LinkDB All DBs
Position
6
AA seq 429 aa AA seqDB search
MRRFFLIHQPTFFISILLGLSLPNWAFGQILFQGFNWESSKKEGGWYNFLKDKVDDIADV
GATHVWLPPPSHSVAEQGYMPGRLYDLDASKYGNKNDLTSLIQAFHNKGIKCIADIVINH
RTAEKQDDRGIYCIFEGGTPDDRLDWGPHMICKDDTQYSDGTGNPDTGLDFKPAPDIDHL
NDRVQKELTDWLNWLKADVGFDGWRLDFAKGYSTNVAKIYVDNTSPNFIVSEIWSSLAPG
QDGKPDPNQDAHRQELVSWAQGVGGPAMAFDFTTKGILNFAVEGELWRMRDENGKATGMI
GWLPEKAVTFVDNHDTGSTQNIWPFPSDKVMQGYTYVLTHPGVPSIFYDHLFDWNLKNEI
SKLAKIRSGNGIQPNSTLRILAADNDLYVAEVDEKIIAKIGLKTDLGNLIPTNFHVVASG
NDYAVWQKT
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaggagattcttcctcattcatcaacccactttcttcatatccatcctactaggcctc
tcgctgcccaattgggcatttggtcagatcctttttcaggggtttaattgggagtcatcg
aagaaagaaggggggtggtacaatttcttgaaggataaagttgatgatatcgctgatgtc
ggggccactcatgtttggcttcctccaccctcacattccgtggcagaacaaggttacatg
ccaggaagactatacgatctcgatgcatcaaaatacggcaacaaaaacgacctgacgtcc
ctaatccaagcattccacaacaaaggaatcaaatgcattgcagacatcgtcataaaccac
agaaccgcagagaaacaggacgacagaggaatatactgcatcttcgagggtggaacccca
gacgaccgcctcgactggggaccccacatgatatgcaaggatgacacccagtattcagat
ggcaccggaaaccctgacaccgggttagatttcaagcccgctccagatattgatcattta
aatgacagggtccaaaaagagctaacagattggcttaactggctaaaggctgatgtcggt
ttcgatgggtggcgcttagattttgcaaaaggatactcaaccaacgtcgcaaagatttat
gtggacaatacttcaccgaactttatagtatcggagatatggagctctttggctcctggt
caagatgggaagccagatcctaaccaagatgcacacagacaggagctggtttcatgggct
caaggggttggagggcctgccatggcttttgattttactacgaaggggatattgaatttc
gctgtagaaggggagttgtggcggatgcgcgatgagaatgggaaagccacggggatgatc
ggatggttgccagagaaggcggtgactttcgtcgataatcatgatacgggttcgactcaa
aacatatggccttttccttctgataaggttatgcaagggtacacctatgttttgacacat
cccggggttccctctattttctatgatcacttgtttgattggaacctcaagaatgaaata
agcaagttggcaaaaatcagatcaggaaacggtattcagccaaatagtaccttgcgcatc
ttggcagcagataatgatctctacgtcgcagaagtcgacgaaaaaataatcgctaaaatt
ggattgaaaactgatttgggcaaccttattcctacaaactttcatgttgttgcttctggt
aatgactatgccgtgtggcagaaaacgtga

DBGET integrated database retrieval system