KEGG   Asparagus officinalis (garden asparagus): 109845629Help
Entry
109845629         CDS       T05243                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00052  Galactose metabolism
aof00500  Starch and sucrose metabolism
aof01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109845629
   00500 Starch and sucrose metabolism
    109845629
Enzymes [BR:aof01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109845629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 109845629
NCBI-ProteinID: XP_020270489
LinkDB All DBs
Position
6
AA seq 876 aa AA seqDB search
MKPYRRLLFFISLCFSCSLSLSQDEPTGNGYKVNSVHIDPSGKSLAAKLQLINSTSVYGP
DIRNLNLFAIFETSNRLRVKITDTDQPRWEIPAQIIPRESENFHRSLSERSQVILQESPH
VLSISDSDLIFTLNNSTPFTFTVTRRSAKDSDPLFNTTAPGIVFKDQYLEISSSLPGNNR
SWLYGLGEHTKKQFKLNAGDTYTLWNSDIAASNLDLPLYGSHPFYLDVRPGGISHGVLLL
NSNGMDITYTGTSISYKVIGGIFDLYFFSGPSPVAVMDQYTELIGRPAPMPYWAFGFHQC
RYGYKNVSDLESVVDGYAKAGIPLEVMWTDIDYMDAYKDFTLDPINFPVDKMLAFVNRLH
NNSQKYVVIIDPGISINNSYGTYLRGIGDGIFLRRNGSNYLGKVWPGDVYFPDFFHPNAS
DYWKEEINIFQKILPVDGLWIDMNEISNFITSQPLNQLDDPPYKIKRAVLEKTVPPSAVH
YGNITEYDAHNLFGLLESKAAHDALTNITGKRPFVLSRSTFVGSGKYAAHWTGDNAANWE
NLGYSIPSILNSGLFGIPMVGADICGFSGDTNEELCRRWIQLGAFYPFSRDHSEINSIRQ
ELYIWESVARSARKALGLRYRLLPYYYTLMYEARVKGTPIARPLFFSFPDDSEALEISTQ
FLIGNGVMISPVLQQGAVSVSAYFPVGKWFNLFNYSDLVIANTGEYVRLDAGSESINVHV
RGGNILAMQQEAMTTKASRLTGFELLVAFDEDGRADGEVFLDDGEVVEMGGEEDLSQWSL
VRFTGSVEAGKGVVKAQVVNGTYAADHKFEVDKLTFLGLETTKPATLKANALYVNGFEVS
KSKGVSVKSEGAGRFGVKGLSQPIGESFELEFEFTS
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccttatcgtcgattgctcttcttcatttctctgtgtttctcctgctctctctct
ctctctcaagatgaacctactggaaatggctacaaggtgaattcggtccatatagacccc
tctggcaagtcattagctgccaagctgcagctcatcaatagcacgtcggtctacggtccg
gacatccggaatctcaatctatttgcaatttttgaaacctccaatcgtctacgagtcaag
atcacagacacagaccaacccagatgggaaattcctgcccagatcatccctcgagagtca
gaaaattttcaccgttcactgtcagaacgcagccaagttatactccaggaatctcctcat
gtactctctatcagtgattctgacctcatcttcactctcaataacagcacgcccttcacc
ttcaccgtcacccgtcgctctgccaaagatagtgacccacttttcaatacaacagcccct
ggcattgtcttcaaagaccagtacctggaaatctcatcttcattgcccggcaacaacaga
tcctggctctatggtctcggtgaacacacaaagaagcaattcaaactcaatgcaggcgac
acgtatacattatggaattctgacattgctgcttcaaacctcgacttgcccctttacggc
tcacacccgttctatttggatgtcagacctggtgggatctcccacggggttcttctactc
aacagtaacggcatggatataacttatacagggactagtattagttataaggtgatcgga
gggatttttgacttgtacttcttctctggtccctcaccggtggcagtgatggatcagtat
acagagctcattggacggccagctccaatgccatactgggcatttggttttcaccagtgt
cggtatgggtacaagaacgtctcggacttggaaagtgttgtcgatggttatgcaaaggct
gggatacctctagaggtcatgtggacagatatagactacatggatgcgtacaaagacttc
actcttgatccaatcaacttcccagttgacaaaatgctagcatttgtcaataggcttcac
aataacagccagaagtacgtagtcatcattgatccaggtattagtatcaacaactcatac
ggtacctacttgagaggcattggcgatggcatctttctgcgaagaaatggcagcaactat
ctcggcaaggtgtggcctggggatgtctacttcccagactttttccacccaaatgcctca
gattactggaaagaagaaatcaatatctttcaaaaaattcttcccgtagatgggttatgg
atcgatatgaacgaaatttccaacttcataacctcacagccgctcaaccaactagatgac
cctccttataagattaaacgggcagttctcgagaaaactgtacccccttccgctgttcac
tacggaaacataactgaatacgatgctcataacttgtttggcctcctggaatcaaaagct
gctcacgatgcgttgaccaatattacaggtaagagaccatttgtacttagccgatcaaca
tttgtgggttcaggaaagtatgcagcacactggactggggacaatgctgctaactgggaa
aacctcgggtactcgataccgtcgatcctaaactctggattgtttggtattccgatggtt
ggagccgacatttgtggtttcagtggcgacaccaacgaggaactatgcaggaggtggatt
cagctaggtgcattctatcctttctcgagggatcactcagaaattaactctattagacag
gagctctacatttgggagtcagtagcccgatctgcaagaaaagcactcgggcttcgatac
cgccttctcccctactactacacgctcatgtatgaagcccgcgtcaagggcacgcctatt
gctaggccgctcttcttctcgttccctgatgattccgaagctcttgaaatcagtacccag
tttctgatcgggaacggagtgatgatatctccagtgctacaacagggagcggtgtcagta
agcgcctacttccccgtagggaagtggttcaacctcttcaactactcagacctggtgata
gctaacaccggagagtacgtgaggcttgatgcagggagcgagagcataaatgttcacgta
cgaggggggaacatactggcgatgcaacaagaagcaatgacgacgaaagcttcgaggctg
acgggctttgagcttctagtggcattcgatgaagacggcagagctgacggggaggtgttt
ttggatgatggggaggtggtggagatgggtggagaggaggacttgagccagtggagcctg
gtgaggttcactggctcggtggaagcggggaagggggttgtgaaggcgcaagttgtgaac
ggcacttacgctgcagaccacaagtttgaggtcgacaagttgacatttctaggtttagag
acgacgaagcctgccacgttgaaggcgaatgctttgtacgtgaacggattcgaagtaagc
aaaagcaaaggagttagcgtgaagagcgagggagcagggaggttcggtgttaaggggtta
tctcaacccatcggagagagcttcgagctggagttcgaatttacgagctga

DBGET integrated database retrieval system