KEGG   Asparagus officinalis (garden asparagus): 109846388Help
Entry
109846388         CDS       T05243                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic-like isoform X1
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00061  Fatty acid biosynthesis
aof00780  Biotin metabolism
aof01100  Metabolic pathways
aof01212  Fatty acid metabolism
Module
aof_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109846388
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    109846388
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    109846388
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aof01004]
    109846388
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     109846388
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     109846388
Lipid biosynthesis proteins [BR:aof01004]
 Fatty acid synthase
  Component type
   109846388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 109846388
NCBI-ProteinID: XP_020271212
LinkDB All DBs
Position
1
AA seq 382 aa AA seqDB search
MRAFVSSGLQMAALRPCICSSQRLLASKSAVSLLDSKITSRRKFKSLCSMPIVQSPLQRS
TSQKFNKVATSAMSSESDKGDAAGLAIDLRGKRAFIAGVADDNGYGWAIAKALAAAGAEI
LVGTWVPALNIFETSLRRGKFDKSRVLPNGSLMEITKVYPLDAVYDTLEDVPEDVKSNKR
YAGASNWTVKEVAETVENDFGSIDILVHSLANGPEVTKPLLETSRKGYLAAISASSYSFV
SLLQNFLPIMNPGGSSVSLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKNKIR
VNTISAGPLGSRAAKAIGFIEKMIEYSYTNAPLQKELLADEVGNAAAFLVSPLASAVTGS
VIYVDNGLNTMGLALDSAAIST
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagagcatttgtgagttcgggtttacaaatggcagcattaagaccctgcatttgttct
tcacaaaggttgttggcgtcaaaatcagcagtctctttgttggattctaaaataaccagc
agaagaaaattcaaaagtttgtgtagtatgccaattgttcagtctcctctccaaagatct
acttctcagaagtttaataaggttgctacaagcgccatgtcaagtgaaagtgacaaaggg
gatgcagcaggtttggctattgatttaagaggtaaaagagcatttattgcgggagttgct
gatgacaatgggtatggttgggcaattgcaaaggctcttgctgctgcaggtgctgaaatt
cttgttggtacatgggttcctgcattgaacatttttgagaccagcttacgacgtgggaaa
ttcgataaatcacgcgtgttaccaaatggatctctgatggaaattactaaagtatatcct
ctagatgctgtttatgatactcttgaggatgttccagaagatgttaaatcaaataaacgt
tatgctggagcttccaattggactgtaaaggaagtagctgagactgtggaaaacgacttt
ggaagcatcgacatccttgtgcattctcttgccaatggacctgaggtgactaaacctctt
ttggaaacgtcccgaaaaggttaccttgctgcgatttctgcatcaagctattcttttgtc
tctttacttcaaaattttcttccaataatgaatccagggggttcttcagtttccttaaca
tacattgcgtctgaaaggatcattcctggatatggtggaggcatgagttcagcaaaagca
gcgctggagagtgatactagggtgctcgcttttgaagctggaaggaagaataagattaga
gtcaatacaatatctgcaggtccgttgggaagtcgagctgcgaaagccatcggcttcatt
gagaagatgattgaatattcttacacaaatgcaccattgcagaaagaactacttgctgat
gaggtgggaaatgccgcagctttcttggtgtcaccattggcttcagcagtgacaggttca
gttatatatgtggataatgggctcaacacgatgggtctcgcacttgatagtgcagcaatt
tccacatga

DBGET integrated database retrieval system