KEGG   Asparagus officinalis (garden asparagus): 109847779Help
Entry
109847779         CDS       T05243                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof00020  Citrate cycle (TCA cycle)
aof00190  Oxidative phosphorylation
aof01100  Metabolic pathways
aof01110  Biosynthesis of secondary metabolites
aof01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109847779
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109847779
Enzymes [BR:aof01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109847779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 109847779
NCBI-ProteinID: XP_020272608
LinkDB All DBs
Position
7
AA seq 577 aa AA seqDB search
MEKSPQENQDPFRSTQNIITNNVHTTGVSCSAKWMGGINAALGNMTEDDWRWHMYDTVKG
SDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTDDGKIYQRAFGGQSLNFGKGGQAYRC
ACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMDNTGTCQGVIALNMEDGTLHRFR
AASTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLIT
EGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHL
NHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTMKGND
PDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLDKD
AGEGTVAWLDKLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQDTLEEGCQLIDEAWESFR
EVQIRDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFAKRDDENWMK
HTLGYWEKEKVRLAYRPVHMNTLDSEIETFPPKARVY
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatctcctcaagaaaatcaggaccctttccgaagtactcaaaatataataact
aataatgtgcatacaacaggtgtatcatgttctgcaaagtggatgggtggtataaatgct
gccttgggtaatatgacggaagatgattggaggtggcatatgtatgataccgtcaaagga
agtgattggttaggtgatcaagatgctatccaatatatgtgcagagaggcacccaaagca
gttatcgaactggaaaattacggattaccattctctagaacagatgatggaaaaatatat
caacgtgcttttggagggcaaagtttgaactttggaaaaggaggtcaggcctatcgttgt
gcatgtgctgcagatagaaccggtcatgcattgttgcatacgctttatgggcaagcaatg
aagcacaatactcagttttttgtggaatactttgcattggatctgataatggataatact
ggcacttgtcagggagtgattgctctcaacatggaggatgggacacttcatcgcttccgt
gctgcatcaacaattttagccactgggggttatggaagagcttatttctctgcaacttca
gctcatacgtgcacaggagatggcaatgctatggttgcacgtgctggattaccacttcag
gatcttgaatttgtacagttccacccgactgggatatatggcgctggctgtctcattact
gaaggatctcgaggtgaaggtggtatccttcggaacagtgaaggagagcgttttatggaa
agatatgctcctactgcaaaagatcttgcatctcgggatgttgtttcaaggtctatgaca
atggaaatcagagaaggtcgtggtgtaggaccactgaaggatcatatttatctgcacttg
aatcatttacctcccgaggttcttaaggaaagacttcctggtatatcagaaactgctgct
atttttgctggtgttgatgtcaccaaggagccaattcctgtcttacctacagttcactac
aacatgggagggatcccgacaaattaccatggggaggttgtaaccatgaaaggaaatgac
ccagatgcagtagttccaggactaatggctgctggggaggcagcatgtgcctctgttcat
ggtgctaatcggctcggtgcaaattcccttcttgatatagttgtttttggcagagcttgt
gctaacagggttgctgagattcacaagccaggagagaagcaaaaacctcttgataaagat
gctggggaagggactgttgcttggttagataagttaagaaactcaaatgggtcattgcca
acttcaaagattcgtctcaatatgcaaagggtgatgcagaataatgctgctgtgttccga
actcaagatactttagaagaaggctgtcagttgattgacgaggcatgggagagtttccgt
gaggtccaaatccgtgatcggtcgttaatatggaattctgacttaatagagactattgaa
ctggaaaatcttttaataaatgcatgtataaccatgcattcggctgaagcaagaaaagag
agtagaggagctcatgcccgtgaagactttgcaaaaagagatgatgagaattggatgaag
cacacactagggtactgggagaaggagaaagttaggctagcatatagacccgtccatatg
aatactctggacagtgaaatcgaaacattccctccaaaagcacgcgtttattga

DBGET integrated database retrieval system