KEGG   Asparagus officinalis (garden asparagus): 109848031Help
Entry
109848031         CDS       T05243                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: RNA polymerase II C-terminal domain phosphatase-like 1
  KO
K18998  RNA polymerase II C-terminal domain phosphatase-like 1/2 [EC:3.1.3.16]
Organism
aof  Asparagus officinalis (garden asparagus)
Brite
KEGG Orthology (KO) [BR:aof00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aof01009]
    109848031
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aof03021]
    109848031
Enzymes [BR:aof01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109848031
Protein phosphatases and associated proteins [BR:aof01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   109848031
Transcription machinery [BR:aof03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     109848031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dsrm NIF HBM
Motif
Other DBs
NCBI-GeneID: 109848031
NCBI-ProteinID: XP_020272884
LinkDB All DBs
Position
7
AA seq 944 aa AA seqDB search
MLRSLVYKGNSFIGEADVSPSSDKTGIWTREIRXSRTSRRRAIGRRPWRSCGLSIRISHL
SPPSDRSPPLAVLWTIAVDGFCFKMEAPSPSPEDQLTSIHDACVREKKTAVVPLGNEELH
LVAMPSKRNSMQYSCFWGFTVASGLYNSCLVMLNLRCLGIVFDLDETLVVANTMRSFEDR
INNLQQKMSNENDQQRLASMLAEIKRYQDDRTILKQFIENDQVVENGKLFKVQAEIVRPL
SESHQQINRPVIRLQEKNIILTRVNPAIRDTSVLVRVRPAWEELRSYLTARGRKRFEVYV
CTMAERDYALEIWRLLDPESNLINSNEILDRIVCVKSELKKSLLSVFQDGKCHPRMSLVI
DDRLAVWDFKDKPRVHVVPAFAPYHAPQAEVVSSVSVLCVARNVACNVRGGFFKEYDDTL
LPRIAAACYEDEVRDLPSAPDVSNYLISEEETSLGNGNNDLLSFDGMADAEVERRLKEAN
CNSQAAPFIVQGANCNGQTVPPMVSNFNHMQMTPVHHVIPSSFGAKPLAASQRILPYSNN
PFPQPTVLMNPPAIEEGEVNDSELDPDTRRRLLILQHGQDVRGPSPLELRPQPEVPVTSI
KSPESWLPKEEEMKPRQKSKASNDYPLQPETIHFNKRLSDEDSYTNRIYHRNKRLTTEVR
NGSDGLHRNYSRSNSLTGEDMSRRSIPTRSRDEHFESGLTQFSKNPVEVLQGIAAESGTK
VEYRITLLNSIELQFSVEAWFLGEKMGEGIGRSRKESQKQAAQEAIQHLADHYLDDFSNP
AAFCERKQSRVEKIDIFSDSNLHGPPTYSRMETLRNPSEENLLKPSDAAVTLKELCTLKG
FSLAFKTDSSLQASSDDKQGVCAQVEIAGQILGKGSGTTWNIAKLKASEEALANLESMLG
QFTQNCLGSSRIVQSPPKKSWKKDCSQILRGSSDNYSKNIIPQS
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatctctagtttacaaagggaactctttcatcggggaggctgacgtcagccct
agcagcgataagacggggatctggacgcgagagattcggnnatctcgcacctctcgccgc
cgagcgatcggtcgccgcccctggcggtcctgtggactatcgattcggatctcgcacctc
tcgccgccgagcgatcggtcgccgcccctggcggtcctgtggactatcgccgtcgatggg
ttctgcttcaagatggaagcgccgtcgccgtcgccggaggatcagttgacttcgatccat
gatgcttgcgtcagagagaagaagacggcagttgttccattaggaaatgaagagctgcat
ttagtggccatgccttccaagagaaactccatgcagtattcatgtttttggggattcacc
gttgcttcaggattgtacaactcttgtctagtgatgctcaatctaagatgccttggcatt
gtgtttgatcttgatgaaacacttgtggttgcaaatactatgcgatcttttgaggaccga
atcaataatctgcagcaaaagatgagtaatgagaatgatcaacaacgtttggcctctatg
ttggctgagattaaacgatatcaagatgacagaactattttgaaacaatttatagagaat
gatcaagttgttgaaaacggaaagctgttcaaagtccaagctgagattgttcggcctttg
tctgagagtcatcaacagattaatcgaccagttataagattgcaagagaaaaacatcatc
ctgactcgtgtcaatccagctatacgtgatactagtgttcttgtacgggttagaccggca
tgggaggaacttcgaagctacttaactgccagaggccgcaagcgttttgaggtttatgtt
tgcaccatggctgagagagattatgctcttgaaatatggcggcttcttgatccagaatca
aacttgatcaattctaatgagattctagatcgaattgtgtgtgttaagtctgaattgaag
aagtcattgctaagtgtctttcaagatgggaagtgtcacccaaggatgtctttagtgatt
gatgatcgtttggcagtgtgggattttaaagataagccacgagttcatgttgttcccgct
tttgccccttaccatgctcctcaagcagaggtggttagttccgtctctgttttatgtgtc
gcaagaaatgttgcatgcaacgttagaggcggttttttcaaagaatatgatgacacttta
ttgccacgcatcgctgctgcttgctatgaagatgaagtgagagatctcccatctgctcca
gatgtgagcaattatctgatttccgaggaagaaacttctctaggaaatggaaacaacgat
cttctttctttcgacggaatggcagatgctgaagttgagaggagattgaaggaggcaaat
tgcaatagccaagctgcaccattcattgtccagggggcaaattgcaacggtcaaactgtt
ccacccatggtcagcaacttcaaccatatgcaaatgactcctgttcatcatgtgatacct
tcatccttcggtgcaaagcctttggcagcttctcaaaggatactgccatactctaataat
ccttttcctcagcctactgtattgatgaacccacctgctattgaagagggtgaagtgaat
gattcagagttagatccagacacaaggagaaggcttctcatattgcagcatgggcaagat
gtaagaggaccttcaccattggaattgagacctcaacctgaagttcctgtcacttctata
aaatctccggaaagttggttaccaaaagaagaagagatgaaaccgagacaaaagagtaaa
gcatccaatgattacccattgcaaccagaaactatccatttcaataagaggctgtctgac
gaggattcatatactaacagaatatatcacagaaacaaaaggcttaccacagaggtgcgt
aatggaagtgatggcctgcatagaaactattcaagatcaaattcattgacaggcgaggat
atgtctcggcgttcaattcctactaggagcagagatgaacattttgaatctggtctcact
cagttctccaaaaatccagttgaagttctacaggggatcgctgcagaatctggaaccaag
gttgagtatcggataactttgttaaacagtatagaactgcagttttctgttgaggcttgg
ttccttggagaaaagatgggagaaggaattgggagatcaaggaaggaaagccagaagcaa
gctgctcaggaagctattcaacatttagcagatcactatctggatgatttttccaatcca
gctgctttttgtgagagaaagcaatctcgtgtcgagaaaatagatattttcagtgactcc
aatttgcatggacccccaacatattcaaggatggaaactttacgaaacccctcagaggaa
aatttgttgaagccatcagatgctgctgtcacccttaaggaactatgtactttgaagggt
ttcagtctagcttttaagactgattcgtcactccaggccagttcagacgataagcaaggt
gtatgtgcacaggttgaaatagcaggacagatactaggaaagggatctggaactacctgg
aacatagctaagttaaaggcttctgaagaggctcttgctaacttggagtctatgctaggt
caattcactcagaattgccttggttcttcaaggatagtgcaaagtcctcctaaaaagagt
tggaagaaagattgttcacaaatactccgtggatcatccgataattactcaaaaaacata
attcctcaatcttga

DBGET integrated database retrieval system