KEGG   Asparagus officinalis (garden asparagus): 109848680Help
Entry
109848680         CDS       T05243                                 

Definition
(RefSeq) dnaJ protein ERDJ2-like
  KO
K09540  translocation protein SEC63
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof03060  Protein export
aof04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aof00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    109848680
   04141 Protein processing in endoplasmic reticulum
    109848680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aof03110]
    109848680
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aof02044]
    109848680
Chaperones and folding catalysts [BR:aof03110]
 Heat shock proteins
  HSP40 / DNAJ
   109848680
Secretion system [BR:aof02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   109848680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ
Motif
Other DBs
NCBI-GeneID: 109848680
NCBI-ProteinID: XP_020273900
LinkDB All DBs
Position
7
AA seq 681 aa AA seqDB search
MAAAEENSSLFLIFILTIMALPLVPYTIVRLCRAFSRKTKSIHCQCVECSRSGKYRKSIF
KRISNFSTCSNLTLVLLWVILGILVYYIKHISEESQPFEPFSILGLEPGVSDSEIKKAYR
RLSILYHPDKNPDPEAHKYFVEFISKAYQALTDPISRENFEKYGHPDGRQGLQMGIALPQ
FLMNFDGASGGVLLIGIVGVCILLPLMIAVIYLSRSSKYTGNYVMRQTLSTYYYFMKPSL
APSKVMDVFIKAAEYMEMPVRRSDDEPLQKLFVAVRSELNLDLKNIKTEQAKFWKQHPSL
VKMELLIQAQLTREAALLSPSLQSDFKRMLELAPRLLEELLKMAVVPRSSQGHGWLRPAV
GVVELSQCIIQAVPLSARKITGGNSEGIASFLQLPHVSETIVKKIGRKKVRTLQELQDMT
VEDRAELLTQVAGLSPSDAHDIETVLDMIPSITVDITIETEGEEGIQEGDVVTMYAWVTL
HRKNGLIGALPHCPYYPFHKEESFWLLLADSVSNEVWMSQKVSFMDEAAAVAAASKAIQE
TKESLGASLKEINVAVREAVEKVRSGSRLVMGKFQAPAEGSYNLSSFCLCDAWIGCDRKT
NVKLKVLKRSRAGTRGHVAEEGPLAEEGIEEEEDEEEEEYDDYESEYSDDEEEDKKKKGK
VANGVGHEEGDSSDEGSESDE
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcagaagagaacagctctctctttctaatattcatcttaactataatggct
ctgcctctagtgccttacacaattgtcaggctatgccgtgcattttctaggaagacgaag
agtatccactgccagtgtgttgaatgttcgcggtccgggaagtatcggaaatccattttt
aaacggatatcaaacttctcaacttgtagcaatcttacactagtgttgctttgggtcatt
ttggggattctggtttattatatcaaacacataagcgaagagagccaaccatttgagcca
ttcagtattcttggactagagccaggggtttcagactctgaaattaagaaggcatatcgt
agactctcaattctctaccatcctgataaaaatcctgatccagaggcacacaagtacttc
gtggaatttatatccaaggcctatcaggccctcactgatcctatatctcgagaaaatttt
gaaaaatatggccatccagatggccgtcagggacttcaaatggggattgctttacctcag
tttttgatgaattttgatggagcatctggtggagtacttttgattggaattgttggagtt
tgcatacttttgccgttgatgatagcagtcatatatctctcgaggtcatcaaaatatact
ggcaattatgttatgcgtcaaactttgtccacatattattatttcatgaagccttcttta
gctccaagcaaggttatggatgtcttcatcaaggctgcagaatacatggagatgccagtt
cgtagaagtgatgatgagcctcttcagaaactctttgtggcagtcagaagtgaactgaat
ctggaccttaaaaacattaagacagagcaagcaaagttctggaaacagcatccatcttta
gttaagatggagttgttgattcaggctcaattaactcgtgaagcagctttattatctcca
tctctccagagtgattttaagagaatgctagaacttgcacctcgccttcttgaagaatta
ctgaagatggctgtagtaccacgcagttcccaagggcatggctggctgagaccagcagtt
ggggtagttgagctttctcagtgtatcatccaggcagttcctctgagtgcaagaaaaata
accggaggaaattcagaaggcattgcgtcctttttgcagcttccacatgtcagtgagaca
attgttaagaaaattggacgaaagaaagtgcgaacattacaagaacttcaagacatgaca
gtagaagaccgtgccgagctcctaactcaagtcgcaggtctctctccctccgatgcccac
gacattgaaactgttcttgacatgatcccttccattactgttgacatcaccattgaaacc
gaaggagaagagggtattcaagaaggtgacgttgtcactatgtacgcttgggtcactctc
catcgtaaaaatggcttaatcggtgcccttcctcattgcccatattaccctttccacaaa
gaagaaagcttttggttattacttgcagattcagtctctaacgaagtatggatgtctcaa
aaggtaagtttcatggacgaggctgcagctgtcgctgccgcctccaaggcaattcaagaa
acgaaggagagtttaggtgcgagtttgaaggaaataaatgttgcagtgagagaagctgtt
gagaaagtgagaagtgggtcaagattggttatgggtaagtttcaggctcccgcagaggga
agctacaatctgagttctttctgtttgtgtgatgcttggattggttgtgatcggaaaacg
aatgtaaaacttaaagttttgaaaaggagtagggcgggaactagaggacatgtggctgaa
gaagggccgctggcagaggagggtatcgaagaggaagaagacgaggaagaagaggaatat
gatgattatgagagtgagtatagtgatgatgaggaggaagataaaaagaagaagggtaag
gtcgccaatggtgttggtcacgaggaaggagattctagtgatgaaggatctgaaagtgat
gagtga

DBGET integrated database retrieval system