KEGG   Anaplasma ovis: AOV_01425Help
Entry
AOV_01425         CDS       T05659                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aoh  Anaplasma ovis
Pathway
aoh00970  Aminoacyl-tRNA biosynthesis
aoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AOV_01425 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aoh03029]
    AOV_01425 (gatB)
Enzymes [BR:aoh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AOV_01425 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AOV_01425 (gatB)
Mitochondrial biogenesis [BR:aoh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AOV_01425 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ASI48167
UniProt: A0A2Z2L981
LinkDB All DBs
Position
354207..355664
Genome map
AA seq 485 aa AA seqDB search
MAADTGIIQGNTHKWEMVIGLEVHAQVVSNSKLFSGASADFCSEPNTQVALFDVAMPGTL
PVLNMRCVEQAVRTSLALSCEVHEHSVFDRKNYFYPDLASGYQITQFHFPIATGGHITLD
ECSNKDVRISRIHLEQDAGKSIHVGDKTYIDFNRAGVALMEIVSEPDLRSPEEAAEYIKK
LRMILRAIGTCDGDMESGSLRCDANVSVRKVGESKLGARSEIKNLNSIKYLTQAIKYEAR
RQVEVLENAGVVSQSTMLFDADTGTTRTTREKEDACDYRYFPDPDLLPLELTKAFIDNIR
ASLPELPSEKRDRYMRDIGLSRYDADILSSDKDVSTYFECVVAKHTPDLAVPWITGELFG
ALNKRGLSITDSPVSAERLVGLLDLIADGTISGKIAKQVFALMFETEKSAPDIVREQGLR
QITSEEALAPIVDRIIAENPAEVAEYRQGKGKLLGYFVGKVMKETGGQANPGLVNALIKR
RLSGD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggataccggaataattcaaggcaatactcataagtgggaaatggttataggc
cttgaagtgcatgctcaagttgtttcaaatagcaagctattctccggagcatctgcagat
ttttgttctgagcccaatacacaagtagcgttgtttgacgtggcaatgccaggaacttta
cccgtgttaaacatgcgttgcgttgagcaggcagttagaacatcactagcactgtcttgt
gaagttcacgagcactcggtttttgaccgaaaaaattatttttatcctgatcttgcgtct
ggctatcagataacgcagtttcatttcccaatcgcaactggtgggcatatcacactcgat
gagtgtagcaataaggacgtcagaatatccaggatccacctagaacaggacgctggtaag
agtatacacgttggagataaaacctacatagactttaacagggctggggtagcactgatg
gaaattgtatctgagcctgacctgcgatctccggaggaggctgctgagtatatcaagaag
ctgcgtatgatactgcgcgctatagggacttgcgatggtgacatggaaagcggttctctg
cgctgtgacgcgaacgtttctgtaagaaaagttggtgaaagcaagttgggtgcgagatct
gagatcaaaaacctcaactctatcaagtatctgactcaggcgataaaatatgaggcgcgc
aggcaagtggaggttcttgaaaatgccggggtagtcagccagagcaccatgttgtttgat
gctgatacgggtaccacaagaacgacacgcgagaaagaagatgcgtgcgattatcgctat
tttccggacccggatttattgcctttggagctcactaaagcatttattgacaatatacgc
gcgtcactacccgagcttccatcagagaagagggatagatacatgcgggacattggccta
tcgcggtatgacgccgatattttatcttcagataaagacgtatccacgtattttgagtgc
gtagtagcaaagcacacaccagatttggccgtaccatggataactggggagcttttcggt
gcgctgaataagcgtgggttaagtattacggattcacccgtaagcgcggaacgtcttgta
gggttattagatttgattgctgatggtacaatatctgggaaaatagccaagcaggttttt
gcgttaatgtttgagacagaaaaatctgctcccgatatagtgcgcgaacaaggcttgcgc
caaataactagtgaagaggctctggctccaatagtagatagaataatcgcagaaaacccg
gccgaagttgcggagtataggcagggcaaagggaagcttctggggtattttgttgggaag
gttatgaaagagactggtggtcaggccaatccagggcttgtgaacgcgttaataaaacgc
cggctttctggggactga

DBGET integrated database retrieval system