KEGG   Anaplasma ovis: AOV_05105Help
Entry
AOV_05105         CDS       T05659                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aoh  Anaplasma ovis
Pathway
aoh00010  Glycolysis / Gluconeogenesis
aoh00020  Citrate cycle (TCA cycle)
aoh00620  Pyruvate metabolism
aoh01100  Metabolic pathways
aoh01110  Biosynthesis of secondary metabolites
aoh01120  Microbial metabolism in diverse environments
aoh01130  Biosynthesis of antibiotics
aoh01200  Carbon metabolism
Module
aoh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOV_05105
   00020 Citrate cycle (TCA cycle)
    AOV_05105
   00620 Pyruvate metabolism
    AOV_05105
Enzymes [BR:aoh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AOV_05105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N DUF5327
Motif
Other DBs
NCBI-ProteinID: ASI48096
UniProt: A0A2Z2LCE0
LinkDB All DBs
Position
complement(1185589..1186887)
Genome map
AA seq 432 aa AA seqDB search
MPVRVLMPALSPTMKSGIVAKWHKKEGDSVKPGDVIADIETDKAVMEFEYVDEPGVLYKI
LTQEGTRDVPVNQVIAVVRVGDEDVESVEALCNVAHGTDAKGPAADTKAATTAAPPASPH
VAASTEKPVQPQPERKRPERGVAYPIPDFVEERKIKATPLAKKLASRLSVDITKISGTGP
YGRVVKADILDAAAGGFPSTTGAAGGDVVEVSSMRRVIADRLLESKLTVPHFYLAVDCMV
GELLKLRVEINDSCADRGTKITVNDFVLKAAALAMREFPEINSSWEGDRIRYHRNINISF
AVSIDGGLITPVVENVDVKSLSEISDITKSLATRAKERKLQPHEFQGGGFTVSNLGMFGV
REFYAIINPPQSCIMAVGQSEKRAVVVDGCVVPADVMTVTLSVDHRSVDGVLAAKFLNRF
KFYIENPLLMLV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccagttagagtattaatgccagcactctctccaaccatgaagagtggcattgtggct
aagtggcacaaaaaagagggagattccgtcaagcctggcgatgtgatcgcagacatagaa
acagacaaggctgtgatggagttcgagtatgtggacgagcctggggttctgtacaagatt
ctcacgcaggaaggcacgagagacgtgccggtaaatcaggttatagctgtagtaagagtg
ggggatgaggacgtagagtccgttgaggcgctgtgcaatgttgcacacggcacagatgca
aagggcccagcagcagatacgaaggcagccaccactgcagcaccaccggctagtccccac
gtagcagccagcacagaaaaaccggtgcagcctcagcctgagcgtaagcggccggagaga
ggagtggcgtacccgatacctgattttgttgaggaacgcaaaattaaggcaacaccgctt
gccaaaaagctcgcttccaggctttcggtggacatcaccaaaatctcgggcactggcccg
tacggcagggtagtcaaggctgatattttggatgcagcagctggcggcttccccagtacg
acaggtgcagcaggtggcgatgttgtggaagtcagcagcatgcgcagggtaatagccgac
cggctattggagtcaaaattgacggtgccgcatttttaccttgcggtagactgcatggtt
ggagagctcttgaaactgagggttgagattaacgacagttgcgctgataggggcactaaa
attacggtcaacgattttgtgctcaaagcagcagcgctggcaatgcgggaatttcccgag
attaattcctcctgggaaggcgacaggataaggtaccataggaacataaacatatcattt
gcggtctcaatagatggggggttgataactccggtcgttgaaaatgtcgatgtaaagtcc
ctatcagagatatctgacatcacaaagagtctagccaccagggctaaggagaggaaattg
cagccccacgaatttcagggaggtgggttcaccgtatctaatttgggaatgttcggggtg
cgtgaattctacgcaatcataaaccccccgcagtcttgtatcatggccgtaggtcagtca
gaaaagcgtgcggttgtcgtggatgggtgcgttgtgcccgcagatgttatgacggttacg
ttgtccgtggaccatagatcagtagatggagtgctggcagcaaagtttttgaacaggttc
aagttttacatagagaacccgttgctgatgctggtatag

DBGET integrated database retrieval system