KEGG   Amycolatopsis orientalis: AORI_0189Help
Entry
AORI_0189         CDS       T02678                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00250  Alanine, aspartate and glutamate metabolism
aoi00410  beta-Alanine metabolism
aoi00640  Propanoate metabolism
aoi00650  Butanoate metabolism
aoi01100  Metabolic pathways
aoi01120  Microbial metabolism in diverse environments
Module
aoi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AORI_0189 (puuE)
   00650 Butanoate metabolism
    AORI_0189 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AORI_0189 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AORI_0189 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aoi01007]
    AORI_0189 (puuE)
Enzymes [BR:aoi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AORI_0189 (puuE)
Amino acid related enzymes [BR:aoi01007]
 Aminotransferase (transaminase)
  Class III
   AORI_0189 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGM02778
UniProt: R4SW74
LinkDB All DBs
Position
complement(196173..197456)
Genome map
AA seq 427 aa AA seqDB search
MTDADLLARHKAVLPSWLALYYDEPIEIVHAQDRRVIDSTGRTYLDFFAGILTNSMGYDV
SAISDAVRKQLDTGILHTSTLYLIRSQVELAERIAKLSGIPDAKVFFTNSGTEANDTALM
LATQYRRSNQVLAMRNSYHGRSFATVGITGNRGWSASSLSPVKVSYVHGGYRYRSPFREL
SDTEYIDACVADLVDVLETGTSGDVACMIAEPIQGVGGFSSPPDGLFKAMKEVLDQYGIL
FISDEVQTGWGRTGEHYWGIQAHDVVPDAMTFAKGLGNGLAIGGLVARGDLVDCLTANSI
STFGGNPVAMAGAAAVLDHIADHDLQANALARGNELLDGLRAAGNPLIGDVRGKGLMIGV
ELVEPGGMTPNPGAAARMMEETKARGLLIGKGGLHGNVLRIAPPMTLTAEEAAEGLGIIV
DALAAIS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgcggacctgctggcgcggcacaaggcggtgctgccgtcgtggctggcgctc
tactacgacgagccgatcgagatcgtgcacgcgcaggaccgccgggtcatcgactcgacc
gggcgcacctacctcgacttcttcgcgggcatcctgacgaactcgatgggctacgacgtc
tcggcgatcagcgacgccgtgcgcaagcagctcgacaccgggatcctgcacacgtcgacg
ctgtacctgatccgctcgcaggtcgaactggccgagcgcatcgcgaagctctccggcatc
cccgacgcgaaggtgttcttcaccaactccgggaccgaagccaacgacaccgcgctcatg
ctcgccacccagtaccggcgcagcaaccaggtgctggcgatgcggaactcgtaccacggg
cggtcgttcgcgacggtcggcatcacgggcaaccgcggctggtcggcgtcgtcgctcagc
ccggtgaaggtgagctacgtgcacggcggctaccggtaccgcagcccgttccgcgagctt
tcggacaccgagtacatcgacgcgtgcgtcgcggacctcgtggacgtcctggagacgggt
acttcgggcgacgtcgcttgcatgatcgccgagccgatccagggcgtcggcggcttcagc
tcaccgccggacggcctgttcaaggcgatgaaggaggtcctcgaccagtacgggatcctg
ttcatctccgacgaggtccagaccggctggggacggaccggggaacactattgggggatc
caggcgcacgacgtcgtccccgacgcgatgaccttcgcgaaggggctcggcaacggcctc
gccatcggcggtctcgtcgcgcgcggcgacctcgtcgactgcctgaccgcgaactcgatc
tcgaccttcggcggcaacccggtcgcgatggcgggcgcggccgcggtgctcgaccacatc
gccgaccacgatctgcaggccaacgcgctcgcccgcggcaacgaactgctcgacggcctg
cgcgcggccgggaacccgctgatcggggacgtgcgcggcaaggggctgatgatcggcgtc
gagctggtcgagccgggcggcatgacgccgaacccgggcgccgcggcgcggatgatggag
gagaccaaggcgcgggggctgctgatcggcaagggcgggctgcatggcaacgtgctgcgg
atcgcgccgccgatgacgctgaccgccgaagaggccgcggagggtctcgggatcatcgtg
gacgcgctggccgccatctcctga

DBGET integrated database retrieval system