KEGG   Amycolatopsis orientalis: AORI_0837Help
Entry
AORI_0837         CDS       T02678                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00020  Citrate cycle (TCA cycle)
aoi00480  Glutathione metabolism
aoi01100  Metabolic pathways
aoi01110  Biosynthesis of secondary metabolites
aoi01120  Microbial metabolism in diverse environments
aoi01130  Biosynthesis of antibiotics
aoi01200  Carbon metabolism
aoi01210  2-Oxocarboxylic acid metabolism
aoi01230  Biosynthesis of amino acids
Module
aoi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aoi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AORI_0837 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AORI_0837 (icd)
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AORI_0837 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGM03426
UniProt: R4STG1
LinkDB All DBs
Position
853444..854667
Genome map
AA seq 407 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDRLIHPYLDVNLEYYDLGIEERDRTDDQITVDS
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGVIFREPIVIQNIPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGPGTLTMTYTPADGSEPMEFQVAQYPEGGGVAM
GMFNFRKSIEDFARASLQYGLDREYPVYMSTKNTILKAYDGMFKDVFEEIYQAEFKADFD
AKGITYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDSNPELIGFANKLE
QVVIETVESGKMTKDLALLISKDQAFQTTEEFLATLDANLAKKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccagggcaccgtcgtcgagctcgacggtgatgagatgacccgc
atcatttggcagttcatcaaggacaggctgatccacccgtacctggacgtgaacctggag
tactacgacctgggcatcgaggagcgggaccgcaccgacgaccagatcaccgtcgactcc
gccaacgcgatcaagaagcacggcgtcggcgtcaagtgcgccacgatcacgccggacgag
gcgcgcgtcgaagagttcggcttgaagaagatgtggctgtcgcccaacgggacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatccagaacatcccgcgcctg
gtaccgggctggaccaagccgatcatcatcggccgtcacgcgcacggtgaccagtacaag
gcgaccaacttcaaggtccccggcccgggcacgctgaccatgacctacaccccggccgac
ggttccgagccgatggagttccaggtcgcgcagtaccccgagggcggcggcgtcgccatg
ggcatgttcaacttccgcaagtccatcgaggacttcgcgcgtgcctcgctgcagtacggc
ctcgaccgcgagtacccggtctacatgtcgaccaagaacaccatcctgaaggcctacgac
ggcatgttcaaggacgtgttcgaggagatctaccaggccgagttcaaggccgacttcgac
gccaagggcatcacctacgaacaccgcctgatcgacgacatggtcgccgcggcgatgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacg
gtcgcgcagggcttcggctcgctgggcctgatgacctcggtgctgcgcaccccggacggc
aagaccgtcgaggccgaggccgcgcacggcacggtgacccggcactaccgccagcaccag
cagggcaagccgacctcgaccaacccgatcgcgtccatcttcgcgtggacccgtggcctc
gagcaccgcggcaagctggactcgaacccggagctgatcggcttcgcgaacaagctggag
caggtcgtcatcgagaccgtcgagagcggcaagatgaccaaggacctcgcgctgctgatc
agcaaggaccaggcgttccagaccaccgaggagttcctcgcgacgctggacgccaacctg
gccaagaagatcgcccagggctga

DBGET integrated database retrieval system