KEGG   Amycolatopsis orientalis: AORI_1194Help
Entry
AORI_1194         CDS       T02678                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00250  Alanine, aspartate and glutamate metabolism
aoi00280  Valine, leucine and isoleucine degradation
aoi00310  Lysine degradation
aoi00410  beta-Alanine metabolism
aoi00640  Propanoate metabolism
aoi00650  Butanoate metabolism
aoi01100  Metabolic pathways
aoi01120  Microbial metabolism in diverse environments
Module
aoi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AORI_1194 (gabT)
   00650 Butanoate metabolism
    AORI_1194 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AORI_1194 (gabT)
   00280 Valine, leucine and isoleucine degradation
    AORI_1194 (gabT)
   00310 Lysine degradation
    AORI_1194 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AORI_1194 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aoi01007]
    AORI_1194 (gabT)
Enzymes [BR:aoi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AORI_1194 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AORI_1194 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     AORI_1194 (gabT)
Amino acid related enzymes [BR:aoi01007]
 Aminotransferase (transaminase)
  Class III
   AORI_1194 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGM03783
UniProt: R4SZ92
LinkDB All DBs
Position
complement(1208743..1210074)
Genome map
AA seq 443 aa AA seqDB search
MTATTETQRRLRTEIPGPASRALQQRRAAVVAAGVSSVLPVYVTSAEGGLLTDADGNVLI
DFGSGIAVTNVGHAAPAVVDRVREQAGRFTHTCFMVTPYEGYVEVCEALDKLTPGTHEKR
SVLFNSGAEAVENAVKIARAATGRQAVVVFDHAYHGRTNLTMALTAKSIPYKHGFGPFAP
EVYRVPGSYPYRDGLSGPEAARIAIDRIEKQIGGDQVAAVVLEPVQGEGGFIEPAPGFLS
ALSRWCTENGVVFVADEVQTGFCRTGEWFASTHEDVVPDLIATAKGIAGGLPLAAVTGRA
ELLDAVGPGGLGGTYGGNPIACAAALGSIEIMRQENLAASAKRIENTVLPRLRALAEVTG
VIGDVRGRGAMLAAEFVKPGTTEPDADLTKRVAQACHQAGVVVLTCGTYGNVVRLLPPLS
LSTELLEEGLSVLEHAVRTEAAK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaccaccgaaacgcagcgcaggctgcgcaccgagatccccggccccgcctcg
cgcgccctgcagcaacggcgcgccgccgtcgtcgccgcgggcgtgagctcggtgctgccc
gtctacgtcacctcggccgaaggcggcctgctcaccgacgccgacggcaacgtcctgatc
gacttcggttccggcatcgcggtgaccaacgtcggccacgccgccccggcggtcgtggac
cgggtccgcgagcaggcaggccggttcacgcacacgtgtttcatggtcacgccgtacgag
ggctacgtcgaggtgtgcgaagcactcgataagctgacgccgggcacgcacgagaagcgt
tcggtgctgttcaactccggcgccgaagccgtcgagaacgcggtgaagatcgctcgcgcc
gcgaccggccgccaggcggtcgtcgtgttcgaccacgcctaccacggccgcaccaacctc
acgatggcgctgaccgcgaagtccatcccctacaagcacggtttcggcccgttcgcgccc
gaggtctaccgggtgccgggctcgtacccgtaccgcgacggtctgtccggccccgaggcc
gcgcgcatcgccatcgaccgcatcgagaagcagatcggcggcgaccaggtcgcggccgtc
gtgctggagccggtccagggggaaggcggcttcatcgagcccgctcccggtttcctgtcc
gcgctttcccgctggtgcaccgagaacggcgtcgtcttcgtcgccgacgaggtgcagacc
gggttctgccgcaccggtgagtggttcgcgtccacgcacgaggacgtcgtgcccgatctg
atcgccaccgccaagggcatcgcgggcgggctgccgctcgccgccgtcaccggccgcgcg
gaactgctcgacgccgtcggtccgggtggcctcggcggcacctacggcggtaacccgatc
gcgtgtgccgcggcgctcggctcgatcgagatcatgcgccaggagaacctcgccgcgtcg
gcgaagcgcatcgagaacacggtgctgccgcggctgcgcgcactggccgaggtgaccggc
gtgatcggcgacgtccgcggccgcggcgcgatgctggccgccgagttcgtgaagccgggc
accaccgaacccgacgccgacctgaccaagcgggtcgcgcaggcctgccaccaggcgggt
gtcgtcgtcctcacctgcggcacctacggcaacgtcgtccgtctgctgccgccgctgtcc
ctgtccaccgaactgctcgaagagggcctgtcggtcctggagcacgctgtccgtacggag
gccgccaagtga

DBGET integrated database retrieval system