KEGG   Amycolatopsis orientalis: AORI_1871Help
Entry
AORI_1871         CDS       T02678                                 

Gene name
lig
Definition
(GenBank) DNA ligase (ATP)
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AORI_1871 (lig)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aoi03400]
    AORI_1871 (lig)
Enzymes [BR:aoi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AORI_1871 (lig)
DNA repair and recombination proteins [BR:aoi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AORI_1871 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGM04459
UniProt: R4SLN4
LinkDB All DBs
Position
2008741..2009658
Genome map
AA seq 305 aa AA seqDB search
MPEERITVEVEGRRLGLSNLDKVLYPAHGFTKREVLDYYRRIAPVMLPHLRDRAATFRRF
PDGVDGEPFYEKNVSRHAPDWVRTARLTNRGRRGGEETLDYPVVGDLPTLMWAANLAALE
LHVPQWTVGPRGARKSPDLLVFDLDPGPPADVVDCCRVAETLSDLLIGDGLTVYAKTSGN
KGMQLYCPVRTRSDERTSEYAKAVAEELARRSPETIVAKMTKAIRPGRVFIDWSQNNTAK
TTIAPYSLRGRAIPTVSTPVTWEEVEACRKAADLLFTAEQVLERVEEMGDLFGDIAEHRA
AVPQR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaggagcggataacggtcgaggtcgagggtcggcggctggggctgtccaatctg
gacaaggtgctctatcccgcgcacgggttcaccaaacgcgaggtcctcgattactaccgc
cggatagccccggtgatgctcccgcatctgcgcgaccgagccgccaccttccgccggttc
cccgacggggtcgacggcgaaccgttctacgagaagaacgtttcccgccacgcgcccgat
tgggtgcgcaccgcgcggctcaccaaccgcggccgccggggcggggaggagacgctcgac
taccccgtcgtcggcgatctcccgacgctgatgtgggcggccaatctcgccgcgctggaa
ctgcatgttccacagtggacggtcggcccgcgcggcgcgcggaaatcccccgatctgctg
gtgttcgacctcgatcccggaccgcccgcggacgtcgtcgactgctgccgggtggccgag
acgctcagcgacctgctcatcggagacggtctcacggtgtacgcgaagaccagcggcaac
aagggaatgcagttgtactgcccggtgcgcacgcgctccgacgaacgcacgtccgagtac
gccaaggccgtcgcggaggaactcgcgcgccggtcaccggaaaccatcgtcgccaagatg
acgaaggccatccgcccaggccgtgtgttcatcgactggagccagaacaacaccgccaag
accaccatcgcgccgtactcgctgcgcggccgcgccatcccgaccgtctccacgccggtg
acctgggaggaggtcgaagcctgccgcaaggccgccgacctgctgttcaccgccgaacaa
gtgctcgaacgcgtcgaggagatgggtgacctgttcggggacatcgccgagcaccgcgcg
gccgttccccaacggtga

DBGET integrated database retrieval system