KEGG   Amycolatopsis orientalis: AORI_2931Help
Entry
AORI_2931         CDS       T02678                                 

Definition
(GenBank) putative multi-domain non-ribosomal peptide synthetase
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00260  Glycine, serine and threonine metabolism
aoi00330  Arginine and proline metabolism
aoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AORI_2931
   00330 Arginine and proline metabolism
    AORI_2931
Enzymes [BR:aoi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     AORI_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 MTS
Motif
Other DBs
NCBI-ProteinID: AGM05517
UniProt: R4T3E2
LinkDB All DBs
Position
complement(3150833..3151648)
Genome map
AA seq 271 aa AA seqDB search
MQRNFKEFKITVDPVRDDFLRAKGPGQRNLLLGRAVFEFASDLEHLDTIQQEFVDGSHRP
LIRRNWQDSTADYSDPTQLLIQGQQVMQNWERPLMKVLAENAAANGGDLLEVGFGMGISA
TYVQDAGVRSHTLIEINSEVKAEFEKWRAQWPDRDIRLELGAWQDVLGGLGQYDAILYDT
YPTDEREFARTLGPKAIVLAAEFFEHAAAHLRPGGVFSYYTNEIDSLSRAHQRALLEHFS
SFRVEVVRDLKPPADCTYWWAGTMAAVTAVK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaacggaacttcaaggaattcaagataacggtggacccggtcagggacgacttcctc
cgggcgaaggggcccggccagcgcaacctccttctcggccgcgcggtgttcgagttcgcc
agcgatctggaacatctggacaccatccagcaggaattcgtcgacggctcgcaccggccg
ctgatccgccggaactggcaggacagcactgcggactacagcgatccgacgcagctgctc
atccagggccagcaggtgatgcagaactgggaacggccgctgatgaaggtgctggcggaa
aacgccgcggcgaacggcggggatctgctcgaagtcggtttcgggatgggtatttcggcc
acctacgtccaggacgcgggcgtccggtcgcacaccctgatcgaaatcaactccgaggtg
aaggcggagttcgagaaatggcgtgcccagtggccggaccgcgatatccggctggaactc
ggcgcctggcaggacgtgctcggcggcctcggccagtacgacgcgatcctgtacgacacc
tatccgaccgacgagcgggaattcgccaggaccctgggcccgaaggccatcgtgctggcg
gccgaattcttcgagcacgccgccgcccaccttcgtcccggtggcgtcttctcctactac
accaacgaaatcgactcactgagccgggcacaccagcgcgccctgctcgaacacttcagc
tcgttccgggtggaggtcgtccgggacctgaagccgccggccgactgcacctactggtgg
gcgggcacgatggccgccgtgaccgccgtcaagtag

DBGET integrated database retrieval system