KEGG   Amycolatopsis orientalis: AORI_4739Help
Entry
AORI_4739         CDS       T02678                                 

Definition
(GenBank) amine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00260  Glycine, serine and threonine metabolism
aoi00330  Arginine and proline metabolism
aoi00340  Histidine metabolism
aoi00350  Tyrosine metabolism
aoi00360  Phenylalanine metabolism
aoi00380  Tryptophan metabolism
aoi01100  Metabolic pathways
aoi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AORI_4739
   00330 Arginine and proline metabolism
    AORI_4739
   00340 Histidine metabolism
    AORI_4739
   00350 Tyrosine metabolism
    AORI_4739
   00360 Phenylalanine metabolism
    AORI_4739
   00380 Tryptophan metabolism
    AORI_4739
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     AORI_4739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 HI0933_like FAD_binding_3 Thi4 FAD_oxidored Pyr_redox_2 Pyr_redox Lycopene_cycl GIDA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AGM07323
UniProt: R4T9Z2
LinkDB All DBs
Position
5239568..5240917
Genome map
AA seq 449 aa AA seqDB search
MIETETEVVVVGAGMAGLMAATALSDRDVVVLEATDRAGGRVESVRQGDYWINLGTQFTE
GTGPLIEALERHQVGMGTLAGKKVALALHGKQVDTSNPFGLMFRSRMTFLDRVGLAAVGA
RILAAAPFLQMNPGNRLAKRVRAKLDATSASYVLRGIGSEVARDMVRSWSGQWMGCEPEE
TAATQFVFSMGILLTDPAKVPNFSLPEGGNQTLTDVLAADLGDRLRLNSPVTSVEWTEDG
VVVDHTDENGPARIRARRAIVAVPSDVAVKLMPGLPPGYRSAFDDIHYGRYVVVGFFTHE
EGPQRWDDYIAVSTPQLSFQAMFNHAAALRGPGARKPGGALACFAGGAVADNLFELTDEE
IVSRFTADLLSLYPELEGKLDEGIVRRHHRVVPFWAPGGRASLPTLRRHLGPVHLAGDYQ
LDMPSLADAASSGELAAEQVRASLPRSAN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaaaccgagacggaagtcgtcgtggtcggtgccggtatggccggcttgatggcg
gcgaccgccctgtccgatcgggacgtcgtcgtgctcgaagccaccgatcgcgccggaggc
cgggtggagtcggtgcgccaaggcgactactggatcaacctcggcacccagttcaccgag
gggaccggcccgctgatcgaagccctcgaacgccaccaggtcgggatggggacgctggcg
ggcaagaaggtggccctcgcgctccacggaaagcaggtcgacacctcgaatccgttcggt
ctgatgttccgctcccggatgaccttcctggaccgggtcgggctggcggccgtcggcgcg
cgcatcctcgccgcggcaccgttcctgcagatgaatcccggcaaccgcctggcgaaacgg
gtcagggcgaagctcgacgcgacatccgcgtcgtacgtgcttcgagggatcggctccgag
gtcgcacgggacatggtccggtcgtggtccgggcaatggatgggctgcgagcccgaggag
accgccgcgacccagttcgtcttctcgatgggcatccttctgacggatccggcgaaggta
cccaacttctccttgccggaagggggaaatcagaccctcaccgacgtactggccgccgac
ctcggcgatcggctgcggctgaactccccggtgacgtcggtggagtggaccgaggacggc
gtcgtcgtggaccacaccgacgagaacggaccggcgcggatacgggcccgtcgcgcgatc
gtcgccgttccgagtgacgtggccgtgaagctcatgcccggcctgccgcccggataccgg
tcggcgttcgacgacatccactacgggcggtacgtggtggtcggcttcttcacccacgaa
gagggcccacagcgatgggacgactacatcgccgtttcgacgccgcagctgtcgttccag
gcgatgttcaaccacgccgcggccctgcgcggtcccggtgcgcggaaaccgggcggcgcg
ctggcctgtttcgcgggtggcgcggtggcggacaacctgttcgaactcaccgacgaggaa
atcgtcagccggttcaccgcggacctcctctcgctctaccccgaactcgaagggaaactc
gacgaggggatcgtccggcgtcaccaccgggtcgtgccgttctgggcgcccggcggacgt
gcctcgctgccgaccctgcgccgccatctcggcccggtgcatctggccggcgactaccag
ctcgacatgccttccctcgccgacgcggcctcgtcgggtgagctggccgccgagcaggtc
cgcgcgagcttgccccgttcggcgaactga

DBGET integrated database retrieval system