KEGG   Amycolatopsis orientalis: AORI_5375Help
Entry
AORI_5375         CDS       T02678                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00627  Aminobenzoate degradation
aoi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AORI_5375
Enzymes [BR:aoi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     AORI_5375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGM07958
UniProt: R4TC09
LinkDB All DBs
Position
5986641..5989184
Genome map
AA seq 847 aa AA seqDB search
MTSTHPISAQLSPISFTSVDPCRAPGWGQVRELVNGTATGNVPGFALSAGGLELSAGFLS
DPQEHPNTDTVLLFTEGDPVWVFYGDDLRYLAVQEQGDLLSIRRGTPYAVSTGFDRGATG
YVVRSDEYLFADTVVRSDLREVAQRHAAARRKNPSRTRSVNGSCTVVPFDSVDPVLTPQG
HRIRPLVDDPSGVGISVGGLEVPAWFLAKAHMHPRTDVIVLVVDCGEEGALTLHGEHLEH
DAVQYRGDLLPIKKGRKYAHTVQNLSPDKSIRAYEFRSQPTVLIDNPQIPELQPTATERG
RAALERLHGADAVAAHLAQPPAQRAAQAASPTPPAHGAAPRVNLAQPGTDTGRRSAKTPT
TSPVAGSPRRHQFIAGEWRDGSMDKVLVDRNPYDGTTVAEFRIAGVDDIDDAYRAAARAR
LEWDRINPYAKRTVFERAVRYVEEHEDAIVEIIVDELGGTRLKAMFEIGLVLNMLKEAAT
FPLRMEGRILPSPIDDKENRVYREPVGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKP
HEDSPITGGTLIAEIFEAAGLPAGLLNVVVTEIPAIGDAFLEHPAPRVISFTGSSAVGRH
VAEVAVRHFKKPLLELGGNSAMIVLADADIDLAVDAAAFSRFTHQGQICMSANRILVHRE
VCEEFTAKFVAKAKSLQVGDPRDAETILGPLINQRQTAALAAQVEQSIAEGATVALRGEV
NGNLFGPTVLTDVTTAMSVMQQEMFGPVACLIPFDTEDEAIDIANDTDFGLSGAVHTRRL
EHGVEIAKRLHTGMVHINDTTIHDEPIVPFGGEKQSGFGRLNGDRSLDEFTTLKWISVHR
GRRQFPY
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgacccaccccatcagcgcgcagttgagcccgatctcgttcacctccgtcgat
ccgtgccgcgcaccggggtgggggcaagtcagagagctggtcaatggcaccgccaccggt
aacgttcccggtttcgcgttgtccgccggcggactggagctgtcggccggtttcctcagc
gacccgcaggaacatcccaacaccgacacggtgctgctgttcaccgagggcgaccccgtg
tgggtcttctacggcgatgacctgcgctatctcgcggtccaggagcagggcgacctgctg
agcatccgccgtggcacgccctacgcggtcagcaccgggttcgaccgcggcgccaccggc
tacgtggtgcgttcggacgagtacctgttcgccgacactgtcgtccggtccgacctgcga
gaagtggcacagcgccacgcggccgcccgccggaagaacccatctcgaacacgctccgtg
aacggtagctgcactgttgtcccgttcgactccgtcgacccggtcctgactccccaggga
caccgaatccggcctctggtcgacgatccctccggggtgggcatttccgtgggcgggctc
gaggtccctgcctggttcctcgccaaggcgcacatgcacccccggaccgatgtgatcgtg
ctggtcgtcgactgcggcgaggaaggggcactcaccctgcacggcgagcacctcgagcac
gatgccgtgcagtaccgcggcgatctcctgcccataaagaagggacggaagtacgcgcac
accgtgcagaatctgagccccgacaagtccatccgcgcctacgaattccgttcccagccg
acggtgctcatcgacaacccccagatcccggagctgcagccgaccgcgaccgagcgcggc
cgtgcggcgctcgaacggctccacggtgccgacgcggtcgccgcgcacctcgctcagccc
ccagcacagcgggctgcccaggccgcgtcgcccacaccacccgctcacggcgccgcgccc
cgcgtcaatctcgctcagccaggcaccgatacagggagacgctcagcgaagacaccgacg
acatcacctgtcgcaggttcgcccaggcgccaccaattcatcgcaggtgagtggcgtgac
ggctcgatggacaaggtcctcgtcgaccggaacccgtatgacggcaccaccgtcgccgag
ttccggatcgcgggagtcgacgacatcgacgacgcgtaccgggcggcggcgcgtgccagg
ctcgaatgggatcggatcaacccctatgccaagcggacggtgttcgagcgagcggtccgg
tacgtcgaggagcatgaggacgcgatcgtggagatcatcgtcgacgagctcggcggtacc
cggctcaaggccatgttcgagatcggcctggtgctgaacatgctcaaggaggcggcgacc
ttcccgctgcgcatggagggccgcatcctgccgtccccgatagacgacaaggagaaccgc
gtctaccgcgaaccggtgggcgtcgtcggtgtcatcagccccttcaacttcccgttcttc
ctgtcgatgaagtcggtggcgcccgcactcggcgccggcaacggcgttgtcctcaaaccg
cacgaggactcacccatcaccggcggcacgctcatcgccgagatcttcgaggcggccggg
ctgcccgcgggcctgctcaacgtcgtcgtgaccgagatcccggcgatcggcgacgcgttc
ctcgaacaccccgcaccgagggtcatctcgttcaccgggtcgtcggccgtcggcaggcac
gtcgccgaggtcgcggtgcggcacttcaagaaaccgctgctggagctgggcggaaacagc
gcgatgatcgtgctggcggacgccgatatcgacctcgcggtcgacgcggcggccttttcc
cgcttcacccaccagggccagatctgcatgtcggcgaaccggatcctcgtccaccgggag
gtgtgtgaggagttcacggcgaagttcgtggcgaaggcgaagtcgctgcaggtcggcgat
cctcgtgacgcggagacgatcctcggaccgctgatcaaccagcggcaaaccgccgcactc
gccgcgcaggtcgagcagagcatcgcggagggtgcgacggtcgcgctgcgcggcgaggtc
aacgggaacctgttcggccccacagtactgacggacgtgacaactgcgatgtcggtgatg
cagcaggagatgttcggtccggtggcgtgcctgatcccgttcgataccgaggacgaggcg
atcgacatcgccaacgacaccgacttcggcctgagcggtgcggtccacactcgccgcctc
gaacacggcgtcgagatcgcgaagcggctccacaccggcatggtccacatcaacgatacg
accatccacgacgagccgatcgtccccttcggcggcgagaagcagtccgggttcgggcgc
ctcaatggtgaccgcagccttgacgagttcaccaccctcaagtggatttctgtccaccgc
gggcgacgacagttcccgtactga

DBGET integrated database retrieval system