KEGG   Amycolatopsis orientalis: AORI_5391Help
Entry
AORI_5391         CDS       T02678                                 

Definition
(GenBank) type I modular polyketide synthase
Organism
aoi  Amycolatopsis orientalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 AMP-binding KR PS-DH Ketoacyl-synt_C PP-binding KAsynt_C_assoc Thioesterase AMP-binding_C adh_short Abhydrolase_6 Thiolase_N Abhydrolase_3 Epimerase Polysacc_synt_2 GDP_Man_Dehyd ACP_syn_III Hydrolase_4 Abhydrolase_1 Lipase_3 NAD_binding_4 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: AGM07974
UniProt: R4SXB9
LinkDB All DBs
Position
6008824..6016476
Genome map
AA seq 2550 aa AA seqDB search
MFADGRYRSWAEWHAEADELARGLQESGVEQGDVIAVHLPNCWDFLTLHVAIATAGAVML
PLHLGLGVAELRSLLERTGAGTIVLPADNRGRSGIELGRQLLENSSALRQVLISGEPDGA
LGDLRRLDDLKRQWQGAAPLPVRVSPDDTFVLLPSSGTTSLRQKICVHTHDGLLSNAATT
AADGQASSTDEIISASPLTHLYGLLSVHLSLVTGGRQALLPSWDVDDFLRLTRQADPTVL
FAVPTQIRDVVSRLDTVGHANECELREVRISGAAVPPTLVEQTRRLMKARVIVHWGMSEL
GGGLFTRPADPPETASRSVGRPISDGEVRIVGDNGGRCGIGQTGHLQYRGRSLFKEYLAD
PELTRAAFTSDGWLRTGDRACLNDDGTIAFRGRDADLINVGGVKFSATEVEALLADLPGL
RQVGIVGRQDDRLGEYPCLVATVLDDASVTLGEVVEHLVAKGTAEYKIPAELIVVEEMPC
TPTGKIAKSRLAAMLGSGDSPAASTWARRLLALSPAEQFTAALDLVRTRVAAVLGRADQI
GPDQIFTDYGLRSLTAVRLRSELVDATGLDLPTTVAFDLPTPRRLAEYLISLVATGRPGP
DRVIAPRPARPSDEDPIVVVGMGCRLPGGITSPAGLWDLLTSGGDAVGDLPADRGWDLGA
VAANARGGGFLTDAAWFDAEFFGISPREAAAMDPQQRLLLETSWEALEHARIDPRSLRDG
DTGVFVGMMASDYLPRPNETTQGFDGAAMTGNQSSVASGRISYVLGLQGPSLTVDTACSS
SLVAIQLAARSLRDGECSLALVGGATVMSTPATFVEFAAQQALSADGRCKSFASSADGTA
WSEAVGMLVLERLSDARRAGHRVLAVIKACAVNQDGTSNGLTAPNGLAQQQVIRRALADA
GLSPSDVDMVEAHGTGTKLGDPIEATAVLATYGQDRTHPLLLGSVKSNLGHTQAAAGVVG
VIKTILAIRHGSVPMTLHVDQPSPHVDWTAGAVRLVTEPVPWPETGRPRRAGVSAFGISG
TNAHVILEQAPVEGDASIARSPLPAVPLILSAATSAALKDQAARLLAGLDAGADPMDTGY
SLATTRARLEHRAVVVDADRAELAALASGEPGAAVTGRSDLPGQTVFVFPGQGAQWAGMG
LELLDSAPVFADAMRECEKTLNEFVDWSLTEVIEDESALERVEVVQPVLFAIMVSLARLW
QSHGVMPDAVVGHSQGEIAAAHVAGVLSLRDAVQMVVRRAALCSSLIGTGLLLSVESTGD
LERRISERPGLTVAAYNGPSSAVLVADAVTITELAEEYRAEGVRARVVPASFPSHSAHVE
SVRDRLLEDLSGIDPQPADIPWYSTVTGRSMRGQEAGVDYWYENLRRPVRFASTVETLVS
AGFAHFIEISPHPVLLPAIQETVGEAGSAVGTLRRDQGGVRRFLTSMAQGYVRGLAVDWA
RLFDGSGARHTDLPTYSFQRRRFWRGRTTRAGAAGLGQEGVTHPLVSALVEAPEQDGSVF
TGRVCLAELDWLGDHRVNGTVVIPGTGLLELALQVGDRFGRERVNELIVLAPLVVPDRGG
VQLQVRVGGEQDGRLAFSIHSRAEGHESWTKHATGELGPDTASPGFTLAAWPPPGAHAVD
PDTIYDALAGAGVVHGPMFRGLRAAWQRDAELFAEVELPERLLGESSAFQLHPALLDGAL
HPAALLGDHSGGPLLPFSWRGVSLFATGATALRVRLRPGDDATGDFAIDIADDRGDPVAR
VESLALRRLADGLSRADAARESLFRIDWTALRHDQCSPSDLAVLDLRAERDLRTILADVV
TAMRNGAATETRSMVLTSHAVSTGEDEDTDPVQAAVWGLVRSAQQENPGLFVLVDTDDPV
TFPPILPSGEPEVALRSGSILVPRLARQPAQSRPVTLDPDGTVVITGGTGTLGRLLATHL
VERYEVRRLLLLSRRGPDAPGADVLRDELSRRGATVDIVACDVGDRASLAEVLTAISPEH
PLTGVVHAAGVLDDGVIGSMTVDRLDHVLRAKADAAWHLHELTLDRPPELFVFFSSIAGL
LGGPGQGNYAAANAYLDGLAAHRRARGLPAVSVAWGLWESDTGMTGMMTATDRARISRAG
IDALSDEDGLRLFDAAVAAGPALLAAMRVDLPAIRRGSARPVWHRIVRPPTRLSVATRAV
AAAATADDLLSGELAGMDEIERTRRVQNLVLSHAAAVLGYSDPAQVDPDREFLHSGFDSL
TAMELRNKLNQVTGLKLPAMAVFESRTPIGLAATVCRAMAERSGVGKTAPPAPEPRYADS
VCSLIRGAADAGRVGEAFGLMRAVADLRPSFDSVVELGPLPEPTTLAEGPPGLRLITLSS
PMADGGVHQHARLAAHFQGVMPVSAISLPGFGPGEKLPATGEAAVRVVSESVLRASAGDP
FVLLGHSSGGALAYATAHYLRTGGQIQPAAVILIDTFRLDDPSVPLDQILRRMFSAEPTF
GAITAERLSAMGRWLAVMSGLRLGPVAAPALFIQATEPFSGETCDVSRSLAEPGEPAHAV
RTVRSDHFTIVGAESGRTSQVIREWLEATL
NT seq 7653 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgcagacggacgctaccgttcctgggcagaatggcatgcggaggcggacgagctg
gctcgggggttgcaggagtcgggagtcgagcagggcgacgtgatcgccgtccatctgccc
aactgctgggatttcctcactcttcacgtcgctatcgccaccgccggcgcggtgatgctt
ccgctgcacctcggcctcggggtggccgaactgcgttcgctgctcgaacgcaccggcgcc
ggcacgatcgtgctccctgccgacaatcgggggcgatccggcatcgagctcggccggcag
ctgctcgagaactcgtcggcgctcaggcaggtgctgatctcaggagagccggacggcgca
ctcggcgacttgcgccggctcgacgacctgaaacgacaatggcagggtgcggcaccgctg
ccggtacgcgtttcgccggacgacacgttcgtcttgttgccctcttcggggacgacttcg
ctacgccagaagatctgcgtgcacacccacgacggccttctgtccaatgccgccacgacc
gccgctgacggccaggcgtcgagtaccgacgaaatcatcagcgccagcccgctcacccac
ctgtacggtctgctctccgtccacctgagtctggtcaccgggggcaggcaagcgctgctg
cccagctgggacgtcgatgactttttgcggttgacgcggcaggccgatccgacggtgctg
ttcgcggtgcccacacagatccgggatgtcgtgtcgcggctggacactgtcgggcacgcg
aacgaatgcgagctgcgggaggtgcggatcagtggcgcggcggtgccccccaccctcgtc
gagcagacgcgccgcctgatgaaggcgcgggtgatcgtccactggggcatgtccgaactg
ggcgggggcctgttcacccggcccgccgacccgccggagaccgcgagccggagcgtcggc
cgtcccatctccgacggtgaagtacggatcgtcggggacaacggcggccgttgtggcatc
ggacagaccggtcacttgcagtatcgcgggcggtctctgttcaaggagtatttggcggat
ccggaactgacacgcgccgcgttcacctccgacggctggctgcgcaccggcgaccgggcc
tgcctgaacgatgacggcacgatcgctttccgtggtcgcgacgcggacctgatcaacgtc
ggcggcgtgaagttcagtgcgacggaagtcgaggcgctgctcgcggacctcccgggcttg
cggcaggtcgggatcgtcgggcgccaagacgatcggctcggcgagtacccctgcttggtc
gcgacggtcctcgacgacgcgtcggtcaccctcggagaggtcgtcgagcatctggtcgcg
aagggaacggcggagtacaagatccccgccgagctgatcgtggtcgaggagatgccctgc
acaccgaccggaaagatcgcgaagagccggctggccgcgatgctcggcagcggcgattcg
cccgcggcgtcgacgtgggcccggcgacttctggcgctgagccccgcggagcagttcacc
gcggcgttggacctggtgcggacgcgggtcgccgcggtgctcggacgcgccgatcagatc
ggaccggaccagatcttcaccgactacggcttacggtcactgaccgcggtcaggctgcgt
tcggaactggtcgacgcgaccgggctcgacctgccgaccaccgttgccttcgacctgccg
acgccccgccggctggctgagtatctgatcagcctggtcgccaccggccgacccggtccg
gaccgggtcatcgcgccgcgaccggcacgaccgagcgacgaggacccgatcgtcgtcgtg
ggtatgggttgcaggttgccaggcggtatcacctcaccggccgggctgtgggacctgctc
acgtcaggcggggacgcggtcggcgacttgcccgccgaccgtggctgggacctcggcgcg
gtcgcggcgaacgcccgcggcggtggcttcctgaccgacgcggcctggttcgacgccgag
ttctttggcatctcgccacgcgaagccgcggcgatggacccgcaacagcggctcttgctg
gaaacatcctgggaagcgctcgaacatgcccggatcgatccgcgttccctgcgcgacggt
gacaccggggtcttcgtcggcatgatggcctcggactatctgccccgcccgaacgagacg
acgcagggcttcgacggcgctgcgatgaccggcaaccagagcagtgtcgcgtccggcagg
atctcctacgtgctggggcttcagggcccgtcgctcaccgtcgacaccgcctgttcatct
tcgctggtcgccatccagctcgcggcgcgctcactgcgcgacggtgagtgttcgcttgcg
ctggtcggtggggccacggtcatgtcgactccggccacctttgtggagttcgccgcgcaa
caggcgctttccgccgatggacggtgcaaatccttcgcttcatcggcggacggtaccgcg
tggtccgaagccgtcggcatgctcgtcctcgaacgtctttcggacgcacgtcgcgccggt
caccgagtactcgccgtcatcaaggcctgcgccgtcaatcaggacggcacctcgaacggc
ttgaccgcacccaacggtctggcgcagcaacaggtgatccgcagggcgctggccgacgcc
gggctctcaccgtccgatgtggacatggtggaggcgcacggcacgggcacgaagctcggc
gacccgatcgaagcgacggcggtgctggcgacctacggacaggaccggacccacccactg
ctgttgggctcggtgaagtcgaatctcggtcacacccaggccgccgccggtgtcgtcggc
gtcatcaagacgatcctggcgatccgccatggatcggtaccgatgaccctgcacgtcgac
caaccgtcgccgcacgtggactggaccgcgggagccgtgcgcctggtcaccgaaccggtg
ccatggcccgagaccggacggccgcggcgcgccggtgtctcggcgttcggcatcagcggc
accaacgcccacgtcatcctggagcaggcaccagtcgagggtgatgcgtccatcgcgcgg
tcaccgctgccggcagtgccgttgatcctctcggcggcgacgtcggcggctctgaaagat
caggcggcgcggctgctcgccggcctggacgcgggtgccgaccccatggacacggggtat
tcattggctacgacacgggcaaggctggagcatcgtgccgtggtcgtcgacgccgaccgc
gccgagctggccgcgctggcttccggcgagcccggcgcggcggtgaccggccgctcggac
ttgcctggccagaccgtgttcgtctttcccggccaaggtgcgcaatgggccgggatgggg
ctcgaactgctcgactccgccccggttttcgcggatgccatgcgcgagtgcgagaagacg
ctgaacgagttcgtcgactggtcgttgaccgaggtcatcgaggacgaatccgcgctggag
cgcgtcgaggtcgtccagccggtcctgttcgcgatcatggtctcgctggcgaggctgtgg
cagtcccatggcgtcatgcccgatgctgtcgtgggccattcccagggtgagatcgccgcc
gcgcatgtcgccggcgtgctctcgttgcgcgacgccgtccagatggtcgtgcgtcgtgcc
gcgctgtgttcctcgctgatcggtaccggcctgttgctgtcggtcgagtcgaccggggac
ctcgagcgacgaatctcggaacggcccggcctgaccgtcgccgcctacaacgggccgtct
tcggcggttcttgtcgcggatgccgtcaccatcaccgagctggccgaggaataccgagcc
gaaggtgttcgggcccgcgtcgtcccggccagttttccgtcgcactccgcgcacgtcgag
tccgtccgggaccggctattggaagacctgtccggtatcgacccgcagcccgcggacatc
ccttggtactccactgttaccggcaggtcgatgcgcgggcaggaggcaggcgtcgactac
tggtacgagaatctgcgtcgaccggtgcggttcgcctcgaccgtggaaaccctggtatcc
gcgggattcgcgcacttcatcgagataagcccgcatcccgtgctgttaccggcgatccag
gagacggtgggagaggccggatcggcagtcggaacgttgcgacgcgaccagggtggtgtc
cgccggtttctgacttcgatggcccaaggctacgtgcgcggcttggccgtcgactgggca
cgtctgttcgacggcagcggagcacggcacacggacctgcccacctattccttccaaaga
cgtcgtttctggcgtggccgcacgacgcgggcgggtgcggccgggctcggtcaggagggc
gtcacccacccgctggtctcggccctcgtcgaagcccccgagcaggacggctcggtgttc
accggccgggtctgcctggccgagctcgactggctgggtgatcaccgcgtgaacggcacg
gtggtgattccgggaacgggcctgctggagctggcgctccaagtcggtgaccggttcggc
cgcgagcgagtgaacgagctgatcgtgctggccccgctggtggtacctgatcgaggtggt
gtccagcttcaggttcgcgtcggcggcgaacaagacggccgcctcgcgttcagcattcat
tccagggccgaaggtcacgagtcgtggacgaagcacgcgaccggagagctcggaccggat
acggcctcgcccggattcaccctcgccgcttggccaccaccgggagcccacgcggtggat
ccggacaccatctacgacgcgcttgccggcgccggcgtggtacacgggccgatgttccgt
ggcctgcgcgcggcctggcagcgcgatgccgaactgttcgccgaggtcgagctgccggag
aggctgcttggcgaatcgtccgccttccagctccatccggcgctgctggacggggcgctg
catccggcagcgttgctcggcgaccattccggtggcccgctgttgccgttctcatggcga
ggagtcagcctgttcgccaccggcgcgacggcgcttcgggtccggctacgacccggtgac
gacgcgacgggtgatttcgccatcgacatcgccgacgaccggggtgatccggtcgcgcgg
gtggaatctctggcccttcgccggctggccgatggtctttcccgggcggacgcggcgcgg
gagtcgctgttcaggatcgactggaccgccttacggcatgatcagtgttcgccgtccgac
ctcgccgtgctggatctgagggccgaacgggacctgcggaccattcttgccgacgtggtc
acggccatgcggaacggtgcggccaccgagacccgatcgatggttctgaccagccacgcg
gtgtccaccggggaggacgaggacaccgatccggtccaggccgcggtatggggtctggtc
cgttcggcccagcaggagaatccgggcttgttcgtcctggtcgacacagatgacccggtg
acgttcccgccgatcctcccctcgggggaacccgaagtcgccctccgctccggctcgatc
ctggtacccaggctcgccaggcaaccggcgcaaagcaggccggtgacgctggaccccgac
ggcaccgtggtgatcaccggtggaaccggcacgctgggccggctactggccacgcatctg
gtcgagcggtacgaggtgcgtcgtctcctgctgctttcccgccggggaccggacgccccc
ggtgcggacgtgcttcgtgacgagctgagccgtcgcggtgcgacagtggacatcgtcgcc
tgtgatgtgggcgaccgcgcttccctcgccgaggtactgaccgcgatctcccccgagcac
ccattgaccggagtggtgcacgcggcgggggtgctcgacgacggggtgatcggctcgatg
accgtcgaccgtctcgaccacgtgcttcgagccaaggccgatgcggcgtggcatctgcac
gaactcactctcgaccgcccaccggagctgttcgtgttcttctcctcgatcgccggcctg
ctcggcggtcccggccagggcaactacgcggcggccaacgcctacctggacgggctggcc
gctcaccgcagggctcgtggcctgccggcggtgtcggtggcatggggcctgtgggaatcc
gataccggcatgaccggcatgatgaccgcgacggaccgcgctcggatttcgcgcgccggc
atcgacgcgctgtccgatgaggacggactccgtctcttcgacgccgcggtcgccgctggt
cccgcgctgctcgcggcgatgcgcgtggacctgcccgccatccggcgcggttcggcgcga
ccggtatggcaccgtatcgtccggccgcccacccggctgagcgtcgcgaccagagcggtc
gcggccgctgcgaccgccgacgacttgttgagcggggagctcgcggggatggacgaaatc
gagcggacgcggcgcgtccagaacctggtgctatctcatgccgccgcggttctgggctac
agcgatccggcccaggtggatccggaccgggagttcctgcacagcggattcgactcgctc
acggcgatggagctgcgaaacaaactcaaccaggtcaccggtttgaagctgcccgcgatg
gccgtattcgagagcaggaccccgatcgggctggccgcgacggtgtgccgtgcgatggcc
gagcgatcgggcgttgggaaaaccgcgccgcccgcaccagaacctcgctacgcggactcg
gtctgttccttgatccgcggtgcggcggatgccggaagggtcggcgaagccttcggcctc
atgcgcgcggtcgcggatctccgcccgtccttcgactcggtcgtcgagctgggaccgttg
cctgagccgaccactctggccgagggaccgcccggccttcggctgatcaccctgagttca
ccgatggccgatggaggcgtccaccagcacgcgcggctcgccgcgcatttccagggcgtc
atgcccgtgtcggcgatctccctccccgggttcgggccgggcgagaagttgcccgccacc
ggcgaggccgcggtacgggtggtctccgaaagcgtgctgcgggcgagcgcgggtgacccg
ttcgtactgctggggcattcctccggcggagcactggcctacgccaccgcccactacctg
cggaccggagggcagatccaacccgccgcggtgattctcatcgacacgttccggctcgac
gacccttcggtgccccttgaccaaatcctgcgtcggatgttttcggccgagccgacattc
ggtgcgatcaccgccgagcggctctccgccatgggtcgctggctcgcggtgatgtccggc
ctgcggctcggcccggtcgccgcgccggcgctgttcatccaagccacagaaccgttctcc
ggcgaaacctgcgacgtgtcccgctcgctggccgagcccggtgagccggcgcacgcggtg
cggaccgtgcgatccgaccatttcaccatagtcggggccgaatcaggtcggaccagccag
gtgatccgggagtggctcgaagcgacattgtga

DBGET integrated database retrieval system