KEGG   Amycolatopsis orientalis: AORI_5397Help
Entry
AORI_5397         CDS       T02678                                 

Gene name
ppsA
Definition
(GenBank) iterative type I polyketide synthase
  KO
K15320  6-methylsalicylic acid synthase [EC:2.3.1.165]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi01059  Biosynthesis of enediyne antibiotics
aoi01100  Metabolic pathways
aoi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    AORI_5397 (ppsA)
Enzymes [BR:aoi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.165  6-methylsalicylic-acid synthase
     AORI_5397 (ppsA)
Polyketide biosynthesis proteins [BR:aoi01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal partially reducing PKS (PR-PKS)
    AORI_5397 (ppsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding Thiolase_N adh_short
Motif
Other DBs
NCBI-ProteinID: AGM07980
UniProt: R4SZL0
LinkDB All DBs
Position
6024788..6029902
Genome map
AA seq 1704 aa AA seqDB search
MKEARSAVSDLPEGRWDAYPAPSEAASGAVRRMIQRASYLDDTAGFDAGFFGITPREAEQ
MDPQQRIVLEVAWESLEHAGIPPRSLAGSVTAVVMGVGGNEYGQLLLSDASRIGPYSSIG
GAYCAVANRVSYALDLLGPSYAVDSACSSSLVAVHAASQALRSGEADLALAGGVNLIPAP
GQSMSLAASGAMAPDGRSKPFSAQADGYGRGEGAGALVLKRKSDALRDGDRILATIVASA
VAQDGRTSGIMAPNGTAQAALLRGLYEKAGVDPASVHYVEAHGTGTSVGDPIEAGAIASV
LGTGRADGEVLIGSIKGNIGHLEAGAGIAGVMKTVLAMTHELLPSTVGPDGPAGVLPDIT
TMPGVRVVDAPTPWPRGESPRRAGVSSFGYGGTIAHVCLEEPAVSPLPPRTTGKPSTQVL
VLSAASAPALRDAAGRLADAVRTGDDRPDLGSAAHTLAVRRSHLPHRLAVVAENWDQAVE
RLDAVSAEKPDDGVVVGRANEPGPGPVWVFSGHGSHWAGMGRELLRDSAEFAQSCQRLDP
VFRQEAGFSLLEEIRHGEFTEVDRIQAALIGIQLGLARMWRARGVRPAAVIGHSVGEISA
AAVAGVWSEEDAVRFACRRASLLRSVAGAGAMVMVALPFPELSDRLAGRTDVTAAIHPSP
DWSVASGDPAAIDELVREWQDRGLTVRRIASDVAFHSAQMEPLLADLGAAAAPLGISEPC
LPLYSTALRDPRSDSPRDPLYWRANLREPVRFGPAIQAALEDGYRTFIEVSTHPVVTHSI
METAARFDSEPVLVVHTLRRRRSQLQEFLAQTGKLYCGGAAIDWAAALPGRLVDLPTQPW
RHERFWLPPARPEDTDAHDPAGHTLLGRRIDVSSVPPTTVWTTSLAPESRPYPTPHVVHG
VDIVPAAVLMGTLGAAAGGRSDIAGGYHLRDISLRTPLPADQRRAVQILSHEGQLTLSSR
LADEESGGNWIVHTTAHVAEPTGAGAPDPYREPLAGSQSFSEDELLGLLAPLGVTGVAFP
WEVRALQHDAAEVDAHVLAPDAETWAPLFDAATTLAALPMARQGVRRMPTFIESVRVCGP
VPRDVQVHARLRSGTSDVVDVDVISRDGASTAQVRGLRFGILDASDDLLSDPRRLLHRLD
WQPMAEFAVTGRAPVIALVAPGPSPLVDRIAQRAAAEDITCITTDCLDALTGADHVLVFP
GDTEAPVRQTELNLGLLARTAQALLSRGEGTARLWAVTAGARECRDDRALSQRPLWGAGR
VIASEHPDLWGGTVDLGAEGTDEAIGRLLRLLHHPPAEDWVALDGPAPEAARMVPVSGIA
PAPLRCAPDGTYVVTGGLGALGLEAARYLVAHGARRLVLIGRRGLPERGLWAEQTDPAIR
HAIDVITSLEQLGVTVQPYSLDIADPDAARILTRADALGLPPVRGIVHAAGVFSGGVIDE
LDETSIHTNLHAKAAGAYVLHELFPPGTLDFLVFFSSTAPLVVLPGCTAYAGANSFLDAL
AHYRRAQAPDTKALAWTAWRNTGMGASFGALEQDAMDSQGFGDITVVEALRAWEYADAMD
AAQAIIVRPTQLPDMQRRPIFEHVKSPKSVELKDDSPAGAALRSADPETLAVTIVEEITR
HIAEETGLPGERIEDNVPFADLGLDSVMAIAIRSRLQRSIELDLPITVLWTNPTPAALAR
HLTERLVAKRATSGAADRAPSLRT
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaggcccgctccgccgtctccgaccttcccgagggacgctgggacgcctatccc
gcgcccagcgaggccgcctccggcgcggtacgccggatgattcagcgggcctcctacctc
gacgataccgcgggattcgacgcgggattcttcggaatcaccccgagagaagccgagcag
atggacccacagcagcgaatcgtgctcgaagtggcttgggaaagtctggagcacgccggc
atcccgccacggtccctggcgggtagtgtcaccgcggtcgtgatgggagtcggcggtaac
gaatacggccagctgctgttgtccgatgcctcccgcatcgggccgtacagcagtatcgga
ggcgcatattgcgcggtggccaaccgcgtttcctacgcgctggacctgctcgggccgagt
tacgcggtggacagcgcttgttcttcttcgctggtcgcagtgcacgcggcgagccaggcc
ctgcgatccggggaggcggacctggcgttggccggcggagtgaacctcattcccgcgccg
gggcagtcgatgtccctggccgcctctggagcgatggctcccgacggaaggagcaagccc
ttctccgcccaggccgacgggtacgggcgtggtgaaggcgccggggcgctggtgcttaag
cggaagtccgacgcactccgtgacggtgaccggatcctggccaccatcgtggcctcggcg
gtggctcaagacgggcgcaccagcggaatcatggccccgaacggtaccgcgcaagccgcg
ctgctgcgaggactctatgagaaggccggtgtggacccggcgagtgtgcactacgtcgag
gcacacgggacggggacctcggtcggcgatccgatcgaggcaggagccatcgcgtcggtc
ctcggaaccggccgggccgacggcgaggtcctgatcggctcgatcaaaggcaatatcggg
catttggaggcaggtgccggtatcgcgggcgtgatgaagacggttctcgcgatgacgcat
gaactgcttccatccactgtcggccccgacggtccggctggggtattgcccgacatcacc
accatgcctggcgtccgcgtggtcgacgcgcccacgccatggccacggggtgaaagtccg
cggcgcgcgggagtgtccagcttcggatacggcggaacgatcgcccatgtgtgcctggaa
gaaccggccgtgtctccgcttcccccgcgcacgacgggaaaaccgtcgactcaggtgctg
gtgttgtcggccgcttccgcgcccgcgctccgggacgccgctggacggctggcggacgcg
gtgcgcaccggagatgaccggcccgacctcggctccgcggcccacacactcgcggtgcgc
cgctcgcacttgccgcaccgcctcgccgtagtggccgagaactgggatcaggcggtggaa
cggctcgacgcggtctccgcggagaagcctgacgacggtgtcgtcgtcggccgggcgaac
gaaccgggacctggcccggtgtgggtgttctccggacatggctcgcactgggcgggaatg
ggacgggaactcctccgggacagcgccgagttcgcacagtcctgccaacggctggacccc
gttttccggcaggaagccggattctccctgctggaggagatccggcacggcgagttcacc
gaggtcgaccgcatccaggcagcgctgatcggtatccagctggggctggccaggatgtgg
cgggcgcgcggtgtccggcctgccgccgtgatcggccattccgtgggagagatttccgcc
gccgcggtggccggggtgtggagcgaggaggacgcggtccgattcgcctgccgccgggcc
tctctgctgcgttccgtagccggggccggagcgatggtgatggtggctctgcccttcccc
gagctcagcgatcggttggccggacgcaccgacgtgaccgcggcgatccatccgtctccg
gactggtccgtcgcctccggcgatcccgccgcgatcgacgagctggtccgcgagtggcag
gaccgaggactgacggtgcggaggatcgcctccgacgtggccttccacagtgcgcagatg
gagccgctgctggccgatctcggcgcggctgccgcgccactgggcatcagcgaaccgtgc
ctgcccctctacagcaccgccctgcgggaccccagaagcgactcgccccgcgatcccctg
tactggcgggccaatctgcgcgaaccggtgcgcttcggaccggcgattcaggccgcgctc
gaagacgggtaccgcaccttcatcgaagtctcgacgcatccggtggtgacacattcgatc
atggagacggcggcgcggttcgactccgaaccggtgctggtggtccacacattgcgccgt
cgccgctcgcaactccaggaattcctggcccaaaccgggaaactgtactgcgggggcgcc
gccatcgactgggccgcagcgcttcccggccgtctggtcgacttgcccacccagccgtgg
cggcacgaacggttctggctgcccccggccaggcccgaggacaccgacgcgcacgacccg
gcagggcacacgctactgggccgccgcatcgacgtcagctcggttccgcccacgacggtc
tggaccacctcgctggctcccgaatcccgcccctatcccactccccacgtcgttcacgga
gtggacatcgtgccggcggcagtcctcatgggaacgcttggcgcggcggccggtggccgg
agcgacattgccggtggctaccacctgcgtgacatctcgctgcgcacgccgcttccggcg
gaccagcggcgtgccgtgcagattctctcccacgaaggacagctgaccctctcgtcccgg
ttggcggacgaggaaagcggcgggaactggatcgtccacaccactgcccacgtcgccgag
cccaccggcgccggtgctccggatccgtaccgcgaacctctcgccgggtcgcagtcattc
tccgaggacgaactcctcggccttctcgcgccgctgggagtcaccggggtcgcctttccc
tgggaggtgcgggctctccagcacgacgccgccgaagtcgacgcacatgtcctcgccccc
gacgccgagacctgggcaccgctcttcgacgccgcgaccacactcgcggccctgccgatg
gccaggcagggggttcgccggatgcccactttcatcgaaagcgtccgcgtctgcggcccc
gttccccgtgacgtgcaggtccacgccaggctgcggagtggtacgtccgacgtcgtcgat
gtcgatgtgatcagccgggacggcgcgtcgacggctcaggtgcgcgggctgcgtttcggc
atcctggacgcttccgacgatctgctctccgacccccggaggctgctgcaccggctggac
tggcagccgatggccgagttcgccgtcaccggcagggcaccggtcatcgccctggtcgcg
cccgggccctccccgctggtagatcgaatcgcgcagcgcgcggcggccgaggacatcacc
tgcatcaccacagactgtctcgacgcgctcaccggcgctgatcacgtactcgtattcccg
ggagacacagaggctccagtgcggcagaccgagctgaacctcggcttgctggcccgtacg
gcgcaggctctgttgtccaggggcgagggcactgctcggttgtgggcggtcaccgccggt
gcccgcgagtgccgggacgatcgcgccttgtcacagcggccgctctggggggccgggcgg
gtcatcgcctcggagcacccggatctgtggggtggaaccgttgatctcggtgcggaaggc
accgacgaagcgatcgggcggctcctgcggctgctgcaccatcctcccgcggaggattgg
gtcgccctcgacgggccggctccggaagccgcccgcatggttcctgtttcgggcatcgct
ccggccccgctaaggtgcgcgccggatggaacctacgtggtgaccggtgggctgggagca
ctcgggctggaagccgcgcgctacctggtcgcgcacggtgctcgcaggcttgtgctcatc
gggcgtcgaggacttcccgaacgcggtctctgggcagagcagacggatccggcgatccgc
cacgcgatcgacgtcatcacgtccttggagcagctcggtgtcactgttcagccctactcc
ttggacatcgccgatcccgacgccgcacggatcttgacgcgagcggatgcgctggggctc
ccccctgtgcgcgggatcgtgcacgccgcaggtgtgttcagcggcggcgtcatcgacgaa
ctcgacgaaacctccatacacaccaaccttcatgccaaagccgcgggtgcctacgtgctc
cacgagctgttcccgccgggaaccctggatttcctggtgttcttctcatccaccgcgcct
ctggtggtacttcccggttgtaccgcgtacgccggcgccaacagttttctcgatgccctc
gcgcactatcggcgtgcccaggcgccggacaccaaagcgcttgcttggacggcttggcgc
aacacgggaatgggcgcttccttcggcgccctggagcaggacgccatggattcgcagggc
ttcggcgacatcacagtcgtggaagcgttgcgtgcctgggaatacgcggacgccatggat
gccgcccaagcgatcatcgttcgcccgacccagcttccggatatgcagcggcgcccgatc
ttcgagcacgtcaagagccccaagtcagtcgagctcaaggacgattcccctgccggtgcc
gcactgcgttcggcggatccggagacactcgcggtcacgatcgtggaggagatcacccgt
catatcgccgaagagacggggcttccgggcgaacggatcgaggacaacgtgcctttcgcc
gacctgggcctggactcggtgatggccatcgccatccgcagccggctgcaacgctccata
gaactggatctgccgatcactgttctgtggaccaatccgacgcctgccgcgctggcccgc
cacttgaccgaacggctggtcgcgaagcgggccacctcaggcgcggcggacagggcgccg
tccctgcggacatag

DBGET integrated database retrieval system