KEGG   Amycolatopsis orientalis: AORI_6411Help
Entry
AORI_6411         CDS       T02678                                 

Definition
(GenBank) 2,2-dialkylglycine decarboxylase (pyruvate)
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
aoi  Amycolatopsis orientalis
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aoi01007]
    AORI_6411
Enzymes [BR:aoi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     AORI_6411
Amino acid related enzymes [BR:aoi01007]
 Aminotransferase (transaminase)
  Class III
   AORI_6411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGM08994
UniProt: R4T077
LinkDB All DBs
Position
7211538..7212866
Genome map
AA seq 442 aa AA seqDB search
MAAPLTDLSTTDRFWADADRHLVRYAGAGDFTREIIDHAAGSYLFTESGRRILDFTSGQM
SAILGHSHPEIVETVRRQIGSLDHLFSGMLSRPVVDLARRLAETLPSPLEKALLLTTGAE
SNEAAIRMAKLVTGKHEIVSFARSWHGMTQAAANATYSAGRKGYGPTAPGNFAIPSPNSY
RPDFTGPDGELDWKRQLDFGFELIDAQSVGSLAACIVEPILSSGGIIEPPVGYFAALQEK
CRERGMLLILDEAQTGLCRTGNWYAFERDGVVPDILTLSKTLGAGLPLAAVITSAEIEQE
AHDRGYLFFTTHVADPLVAAVGNTVLDVLTRDRLDERATELGAFLRRGLDDIAARHPVVG
DIRGRGLLVGVELVVDRATKRSSDELGALVTRRCLELGLHMNIVQLPGMGGVFRIAPPLT
ATEDELAEGLAVLDKAIGDASN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcccctcaccgacctgtccaccaccgaccgtttctgggccgacgccgaccgg
cacctcgtgcgctacgccggggccggcgatttcacccgcgagatcatcgaccacgccgcc
gggagctacctgttcaccgagtccgggcggcggatcctcgacttcacctccgggcagatg
agcgcgatcctcgggcattcgcatccggagatcgtcgagaccgtgcggcggcagatcggc
tcgctggaccatctgttcagcgggatgctgagccgccccgtcgtcgacctcgcgcgacgg
ctggcggagaccctgccgtcgccgctggagaaggcgctgctgctgaccaccggcgcggag
tcgaacgaggccgcgatccggatggcgaaactggtgaccgggaagcacgagatcgtgtcg
ttcgcccggtcgtggcacgggatgacgcaagcggccgcgaacgcgacctacagcgcgggc
cgcaagggttacggcccgaccgcgcccggcaacttcgccattccctcgccgaactcgtat
cggccggatttcaccggcccggacggggaactggactggaaacgccagctggacttcgga
ttcgagctgatcgacgcccagtccgtcggcagtctcgcggcgtgcatcgtcgagccgatc
ctcagctccggcgggatcatcgagccgccggtgggctatttcgccgccctgcaagagaaa
tgccgtgaacgcgggatgctgctgatcctcgacgaggcgcagaccggcttatgccgcacg
ggaaactggtacgccttcgaacgcgacggcgtcgtcccggacatcctcacgctgtccaag
acgctgggcgccggtctcccgctggcggcggtgatcacgagcgcggaaatcgagcaggag
gcgcacgaccgcggctatctgttcttcaccacgcacgtcgcggacccgctggtggcggcc
gtcgggaacaccgtgctcgacgtcctgacccgcgaccgcctcgacgaacgcgccaccgag
ctgggcgccttcctccgccgcggcctcgacgacatcgccgcccgtcatcccgtcgtcggc
gacatccggggacggggcctgctggtcggcgtcgaactcgtcgtggaccgcgccacgaaa
cggagttccgacgaactgggcgcgctggtcacgcgacgctgcctcgaactggggctgcac
atgaacatcgtgcagttaccggggatgggcggggtcttccggatcgctcccccgctgacg
gccaccgaagacgaactggcggaggggctggcggtgctggacaaggcgatcggggacgca
agcaattga

DBGET integrated database retrieval system