KEGG   Amycolatopsis orientalis: AORI_7353Help
Entry
AORI_7353         CDS       T02678                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00500  Starch and sucrose metabolism
aoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AORI_7353
Enzymes [BR:aoi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AORI_7353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AGM09935
UniProt: R4T546
LinkDB All DBs
Position
complement(8157110..8159278)
Genome map
AA seq 722 aa AA seqDB search
MRKLVLPALTGVLIAGLVPAVAEAQGGEAPGAPGAHPSWLPADKTGFGTAREQVSNVWFT
LQGGRMSEVYYPDLSTPAVRALDLVVTDGTSFATVDSSAKAQQVRRTGGLTYEQTITDDH
RRWKLRKTYVTDPARASVLIDVDFVSLTGRPYQVYAVADPDLTNEGSDDSARADGASAVS
SDAKTAAALAAEPAFSRTSVGYSGSSDGITQLTKSFSLKDYATAAKGNVLITGQTSADGV
RSRDFTLSLGMGAKDTDALANAKASLRRGFADAARAYDRGWKQYLRQLKDAPSSLKTKQE
RDLYQASVLMLAASEDKIHRGALIASPSMPWRFGNNDPEWSPSGTYHLVWPRDLYQIATG
LLAAGDRDAANRSVDYMFGTQQLPDGHLPQNSHVDGTPYWTSIQLDETALPIVLAQQLGR
TDAKTWRGVRKAAEFLLSYKADNGHASPYSQQERWEEQDGYSPSTIAAVIAGLVCAADLA
KANGAAGDAKRYLDTADAFKAKLAQWTVTTNGPLSKDPYFVRLTKDGNANNGTKYNLGNS
SVTMDQRAVTDAGFLELVRLGIYRADDPVIRNSIKVTDADIAFTTPTGQFWHRYTKDGYG
EKADGSPWDYTFPAESRTTFGRLWPLLAGERGEYDLANGDRGTAAKRLRDLGRVSSSGDT
MPEQVWDENAPSGQPGFPAGTPTASATPLAWTHAQYLRLAWSVEAGKVIEQPRVVRCHFL
GC
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaactcgtgctcccggcactgacaggcgtgctgatcgcggggctggtccccgcg
gtcgccgaagcccagggtggtgaggcgccaggcgcgcccggcgcccatccgagctggctg
cctgccgacaagaccggcttcggcaccgcccgcgagcaggtcagcaacgtctggttcacc
ctgcagggcggccggatgtccgaggtctactacccggatctgtcgacaccggccgttcgc
gcgctcgacctcgtcgtcaccgacgggacgagcttcgcgaccgtcgattcctcggccaag
gcccagcaggtgcgccgcaccggcggcctcacctacgaacagaccatcaccgacgaccac
cgccggtggaagctccgcaagacctacgtcaccgacccggcacgcgcgagtgtgctgatc
gacgtcgacttcgtctcgctgaccggccgcccgtaccaggtgtacgcggtcgcggatccc
gatctcaccaacgaaggctccgacgactccgcgcgcgccgacggtgcgagcgcggtctca
tcggatgcgaagacggctgccgcgctggcggcggaaccggcgttctcgcggacttccgtg
gggtattcgggctcctccgacggcatcacgcagctgacgaaatcgttcagcctcaaggat
tacgcgaccgcggccaagggcaacgtactgatcaccgggcagacctccgccgacggcgtc
cgctcgcgggacttcacgctttcgctgggtatgggcgccaaggacaccgacgcgctcgcc
aacgcgaaagcctctctacggcgcggattcgccgacgccgcccgcgcgtacgaccggggc
tggaagcagtatctccgtcagctgaaggacgcgccgtcgtcgctgaagaccaagcaggag
cgggacctctaccaggcgtccgtgctcatgctcgcggcgagcgaggacaagatccaccgt
ggcgcgctcatcgcttcgccgagcatgccgtggcggttcgggaacaacgacccggaatgg
tcgccgtcgggcacctatcacctggtctggccgcgtgacctctaccagatcgcgaccggg
ctgctcgccgccggcgaccgcgacgccgcgaaccggtcggtcgactacatgttcggcacg
cagcagctgccggacgggcatctgccgcagaacagccacgtcgacggcacgccgtactgg
acgtccatccagctcgacgagaccgcgctgccgatcgtgctcgcgcagcagctcggccgc
accgacgcgaagacctggcggggtgtgcgcaaggcggcggaattcctgttgtcctacaag
gcggacaacgggcacgcgtcgccctacagccagcaggaacgctgggaggagcaggacggc
tactcgccctcgacgatcgccgcggtgatcgccgggctggtctgcgcggccgacctcgcc
aaggcgaacggcgcagcgggtgacgcgaagcgctatctcgacaccgccgacgccttcaag
gcgaagctcgcccagtggacggtgaccacgaacggcccgctgtcgaaggacccgtacttc
gtccggctgaccaaggacggcaacgcgaacaacggcacgaagtacaacctcggcaactcc
agcgtgaccatggaccagcgtgcggtgaccgacgccggattcctcgaactggtgaggctg
ggcatctaccgcgccgacgatccggtgatcaggaacagcatcaaggtcaccgatgccgac
atcgcgttcaccacgccgacggggcagttctggcaccgttacacgaaggacggatacggc
gagaaggccgacggctcgccgtgggactacacgttcccggccgaaagccggaccaccttc
gggcgactgtggccgctgctcgcgggtgaacgcggcgagtacgacctcgccaatggtgac
cggggtacggccgcgaagcggcttcgcgacctcgggcgcgtcagtagttcgggggacacg
atgccggagcaggtctgggacgagaacgcgccttcggggcagccgggcttcccggcgggc
acgccgaccgcgtccgcgacgccgctggcctggacgcacgcccagtacctccggctcgcg
tggtcggtggaggccgggaaggtgatcgagcagcctcgggtcgtgcggtgccacttcctg
gggtgctga

DBGET integrated database retrieval system