KEGG   Amycolatopsis orientalis: AORI_7642Help
Entry
AORI_7642         CDS       T02678                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi00250  Alanine, aspartate and glutamate metabolism
aoi00410  beta-Alanine metabolism
aoi00430  Taurine and hypotaurine metabolism
aoi00650  Butanoate metabolism
aoi01100  Metabolic pathways
aoi01110  Biosynthesis of secondary metabolites
aoi01120  Microbial metabolism in diverse environments
aoi02024  Quorum sensing
Module
aoi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AORI_7642 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AORI_7642 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AORI_7642 (gadB)
   00430 Taurine and hypotaurine metabolism
    AORI_7642 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AORI_7642 (gadB)
Enzymes [BR:aoi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AORI_7642 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGM10224
UniProt: R4T3N8
LinkDB All DBs
Position
complement(8453906..8455279)
Genome map
AA seq 457 aa AA seqDB search
MVLHKGTASDPDRKTGANPLYAGAYPALAANIRLPHDSLAEDPLPPDTALQLVRDELMLD
GNARLNLATFVTTWMEPQARELMAECVDKNMIDKDEYPQTAELERRCVNILADLWHAPDP
TAIMGCSTTGSSEACMLAGMALKRRWSKLGRTGKPNLVMGANVQVCWEKFCEYWEVEPRL
VPMDGDRFHLTADEAIARCDENTIGVVAILGSTFDGSYEPVAEIAAALDGLAERSGWDIP
VHVDGASGAMIAPFLDPDLSWDFRLLRVASINTSGHKYGLVYPGVGWVLWRDKEALPEEL
VLNVNYLGGDMPTFALNFSRPGAEVAAQYYTFVRLGREGFRAVQQASRDVATQLADGIAE
LGPFRLLTRGDQLPVFAFTTKPDVEGFDVFDVSRRLRERGWLVPAYTFPENRTDLAVLRI
VVRNGFTHDLADLLLADLRRLLPELDHGPRRRTAFHH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcacaagggaaccgcgtccgatccggaccgcaagaccggggccaacccgctg
tacgccggcgcgtatcccgcgctcgccgcgaacatccgtctcccgcacgacagcctcgcc
gaagacccgctcccgcccgacaccgcgctccagctggtgcgcgacgagctgatgctcgac
ggtaacgcccggctcaacctcgccacgttcgtcaccacgtggatggagccgcaggcccgc
gagctgatggccgaatgcgtcgacaagaacatgatcgacaaggacgagtacccgcagacc
gcggaactcgagcggcgctgcgtcaacatcctcgccgatctgtggcacgcgcccgatccc
accgcgatcatgggctgttccaccaccggttcgtcggaagcctgcatgctcgccggcatg
gcgctgaagcgccgctggtcgaagctgggccgcaccggcaagccgaatctggtgatgggc
gcgaacgtccaggtctgctgggagaagttctgcgagtattgggaggtcgagccgcggctg
gtgccgatggacggcgaccgtttccatctcaccgccgacgaggcgatcgcccgctgcgac
gagaacacgatcggcgtcgtcgcgatcctcgggtccactttcgacggcagctacgagccg
gtcgccgagatcgccgccgcgctcgacggcctggcggaacgctccggctgggacatcccg
gtgcacgtcgacggcgcttcgggcgcgatgatcgcgcccttcctcgatccggatctgagc
tgggacttccgcctgctgagggtggcgtcgatcaacacctccgggcacaagtacgggctc
gtctaccccggcgtcggctgggtgctgtggcgcgacaaggaggcgttgccggaggagctc
gtcttgaacgtcaactacctcggtggcgacatgccgactttcgcgttgaacttctcccgc
cccggcgccgaggtggccgcgcagtactacacgttcgtccggctcggccgcgaaggtttc
cgtgccgtgcaacaggcttcgcgtgacgtcgcgacccagctggcggacgggatcgccgag
ctgggcccgttccggctgctgacacgcggtgatcagctgcccgtgttcgccttcacgacg
aagccggacgtcgagggcttcgacgtcttcgacgtgtcacggcggcttcgcgagcgtggc
tggctcgtcccggcgtacacgttcccggagaaccggaccgacctcgcggtgctgaggatc
gtggtgcgcaacggtttcacccacgacctcgccgatctgctgctcgccgatctccgccgc
ctgctgcccgagctcgatcacggcccgcgacggcggaccgcgttccatcactga

DBGET integrated database retrieval system