KEGG   Amycolatopsis orientalis: AORI_7746Help
Entry
AORI_7746         CDS       T02678                                 

Gene name
pstB
Definition
(GenBank) phosphate transport system ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
aoi  Amycolatopsis orientalis
Pathway
aoi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AORI_7746 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aoi02000]
    AORI_7746 (pstB)
Enzymes [BR:aoi01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     AORI_7746 (pstB)
Transporters [BR:aoi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    AORI_7746 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 AAA_16 Rad17 AAA_30 RsgA_GTPase AAA_33 AAA_23 AAA_18 AAA_15 AAA_28 PRK
Motif
Other DBs
NCBI-ProteinID: AGM10328
UniProt: R4TJF7
LinkDB All DBs
Position
complement(8564481..8565257)
Genome map
AA seq 258 aa AA seqDB search
MAKRIDVKDVDIYYGKFHAVDGVTLSVPPRNVTAFIGPSGCGKSTVLRTLNRMHEVIPGA
RVEGEVLLDGEDIYGAGVDPVQVRRTIGMVFQRPNPFPTMSIRDNVVAGLRLGGTKGKKE
LDDVAERALRGANLWNEVKDRLNKPGGGLSGGQQQRLCIARAIAVRPDVLLMDEPCSALD
PISTLAIEDLIGELKKEYTIVIVTHNMQQAARVSDQTAFFNLAGVGQPGRLVELNDTEKI
FSNPDEKATEDYISGRFG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgaatcgacgtcaaagacgtggacatctactacggcaaattccacgccgtg
gacggcgtcaccctctcggtgccgccgcggaacgtcaccgcgttcatcggcccgtcgggc
tgcggcaagtcgacggtgctgcgcacgctgaaccggatgcacgaggtcatccccggcgcc
cgcgtcgagggtgaggtgctgctcgacggcgaggacatctacggcgccggggtcgacccg
gtgcaggtccgccgcacgatcggcatggtgttccagcgccccaacccgttcccgacgatg
tccatccgcgacaacgtcgtggcgggcctgcgcctcggcggcaccaagggcaagaaggag
ctcgacgacgtcgccgagcgcgccctgcgcggcgcgaacctgtggaacgaggtcaaggac
cggctgaacaagccgggcggcggcctctccggtggtcagcagcagcggctctgcatcgcg
cgggcgatcgccgtgcggcccgacgtgctgctgatggacgagccgtgctccgcgctcgac
ccgatctcgacgctcgccatcgaggacctgatcggtgagctcaagaaggagtacacgatc
gtcatcgtgacgcacaacatgcagcaggcggcgcgggtctcggaccagaccgcgttcttc
aacctggcgggcgtcggccagccggggcgcctggtggagctgaacgacacggagaagatc
ttctcgaacccggacgagaaggcgaccgaggactacatctcgggccgcttcggctag

DBGET integrated database retrieval system