KEGG   Amycolatopsis orientalis: AORI_7953Help
Entry
AORI_7953         CDS       T02678                                 

Definition
(GenBank) polar amino acid transport system substrate-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
aoi  Amycolatopsis orientalis
Brite
KEGG Orthology (KO) [BR:aoi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aoi02000]
    AORI_7953
Transporters [BR:aoi02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    AORI_7953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1
Motif
Other DBs
NCBI-ProteinID: AGM10534
UniProt: R4T4K8
LinkDB All DBs
Position
complement(8762485..8763297)
Genome map
AA seq 270 aa AA seqDB search
MARFKALALIPALALAAGALSACGEEGGTAAGGVQLVASGKVTTCTHLPYQPFQVKQGDK
IVGFDVDLVDLVGKKLGVEQSIVDIAFETIESGEAMNTGQCDLAAAGMTITDKRKEKFDF
SDPYFEATQALLVKTGSPIKDLSNVAGKKIGVQSATTGADYAKEKAAGAEIVTFDDLALL
EQAVKNGTVDAGVNDNGVLYDFAKTNPDTTVVTEFKTNEFYGIGVKKGNSALLGKINEVL
KASAADGSYAQIYQKWFGKAPTWQPGAASN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgattcaaagcgctcgccctgatcccggcgctcgccctggccgcgggtgcgctg
tccgcgtgcggcgaggaaggcggaaccgcggccggcggcgtccagctcgtcgcgtccggc
aaggtcaccacctgcacgcacctgccctaccagcccttccaggtcaagcagggcgacaag
atcgtcggcttcgacgtcgacctggtcgacctggtcggcaagaagctgggtgtcgagcag
agcatcgtcgacatcgccttcgagaccatcgagtccggcgaagcgatgaacaccgggcag
tgtgacctcgccgccgcgggcatgacgatcaccgacaagcgcaaggagaagttcgacttc
tccgacccgtacttcgaggcgacccaggcgctgctggtcaagaccggttcgccgatcaag
gacctgtccaacgtcgcgggcaagaagatcggtgtccagtcggccaccaccggcgccgac
tacgccaaggagaaggccgccggcgccgagatcgtcaccttcgacgacctagcgctgctg
gagcaggccgtcaagaacggcacggtcgacgcgggcgtcaacgacaacggcgtgctctac
gacttcgcgaagacgaacccggacacgacggtcgtcaccgagttcaagacgaacgagttc
tacggcatcggcgtgaagaagggcaacagcgccctgctcggcaagatcaacgaggtgctc
aaggcgtccgcggcggacggctcctacgcgcagatctaccagaagtggttcggcaaggcg
ccgacctggcagcccggagctgcgtcgaactag

DBGET integrated database retrieval system