KEGG   Alistipes onderdonkii subsp. vulgaris: A3BBH6_14940Help
Entry
A3BBH6_14940      CDS       T06406                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aok  Alistipes onderdonkii subsp. vulgaris
Brite
KEGG Orthology (KO) [BR:aok00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3BBH6_14940
Enzymes [BR:aok01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A3BBH6_14940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 GIDA DAO Thioredoxin_3 NAD_binding_7 Thi4 FAD_oxidored AlaDh_PNT_C FAD_binding_3 NAD_binding_8 K_oxygenase Ribosomal_L12_N Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: BBL01258
UniProt: A0A4Y1WML0
LinkDB All DBs
Position
complement(1755224..1756774)
Genome map
AA seq 516 aa AA seqDB search
MLDHALREQLLRLFEGLEASYVFDVTADPGHASRGELLELLEETAACSAKIGCRITDGQG
LEFRLLRNDKDTGIHFRAVPNGHEFSSLILAVLNADGKGKNLPDEATRRRIGALGGQIAL
TTYMSLTCTNCPDVVQALNLLALSNPRITHTAVDGALFPEEVARLNIQAVPAVFHGEELI
HVGRGSLAELLDKLEERFGTSDTGITPVVREYDLLVAGGGPAGASAAIYAARKGLRVAVV
AEKVGGQVNETVGIENLVSVPRTTGAELAGDLRRHMEAYGIDICDNRRIERFDMDGGIRE
LHAKGGEVFRAPALVVATGASWRRLGVPGEAEYIGRGVAFCPHCDGPFYAGKHIAVIGGG
NSGVEAAIDLAGTCASVTVLEFMETLKADQVLQEKLRTLPNVAVHTNVQTLEVEGDGSRM
TALRTKDRPTGAEKRLLLDGVFVQIGLSANSKLFAGILDTNRAGEILTDKECRTSVPGVY
AAGDVTDIRYKQIVIAMGEGAKAALSASEDRIKGII
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcatgcactcagggagcagttgctccgcttgttcgaggggctggaagcctcc
tacgtgttcgacgtcacggccgaccccggccatgcgtcgcgcggagagctgctcgagctg
ctcgaagagacggccgcctgttccgcgaagatcggctgccggatcaccgacgggcaggga
ctggagttccggcttctgcgcaacgacaaggacaccggcatccacttccgggcggtgccc
aacggccatgaattcagctcgctgatactggccgtgctgaacgccgacggcaagggcaaa
aacctgcccgacgaagcgacgcgccgacggatcggggcgctcggcgggcagatcgcgctg
acgacctacatgtcgctcacctgcaccaactgccccgatgtggtacaggcgctcaacctg
ctggcgctctccaacccccggatcacccatacggccgtggacggagccctgttccccgag
gaggttgcacggctgaatatccaggccgtgccggcggttttccacggcgaagagctgatc
cacgtcggccgcggctcgctggccgaactgctggacaaactcgaggagcgcttcggcact
tcggacacaggcatcacgcccgtcgtgcgcgaatacgacctgctggtcgccgggggcggc
cccgccggggcttcggccgcgatctatgcagcccgcaaggggctccgcgtggcggtcgtg
gcagaaaaggtcggcgggcaggtcaatgaaacggtaggcattgaaaacctggtctcggtg
ccgcgcacgaccggagcagagctcgcgggcgacctgcgcagacacatggaggcctacggg
attgacatctgcgacaaccgccgcatcgaacgtttcgacatggacggcggcatccgggag
ctgcatgccaaaggcggggaggttttccgcgccccggcactggtcgtcgccacgggagct
tcgtggcgcaggctcggggtgccgggcgaagcggagtacatcggccgcggcgtagccttc
tgcccccactgcgacgggccgttctacgccgggaagcatatcgctgtgatcggcggcggc
aattcgggcgtcgaggccgcaatcgacctggcgggcacctgcgcttcggtgacggttctc
gaattcatggagactctcaaggccgaccaggtattgcaggagaagctgcgcacgctcccc
aatgtagcggtacatacgaacgtgcagacgctcgaggtcgaaggcgacggcagccgcatg
acggccctgcgcacgaaagaccgcccgacgggagcggaaaaacgactgctgctcgacggc
gtattcgtccagatcggcctctcggccaacagcaagctgttcgccggcatcctcgacacc
aaccgcgcgggagaaatcctgaccgacaaggagtgccgcacatcggtacccggcgtatat
gcagcgggcgacgtgacggacatacgttacaaacagatcgtgatcgcaatgggcgaaggg
gccaaggcagccctgtcggcctcggaagaccggatcaagggaataatttga

DBGET integrated database retrieval system