KEGG   Bradyrhizobium oligotrophicum: S58_07320Help
Entry
S58_07320         CDS       T02484                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    S58_07320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aol02000]
    S58_07320
Enzymes [BR:aol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     S58_07320
Transporters [BR:aol02000]
 Other Transporters
  Pores ion channels [TC:1]
   S58_07320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N_2 GST_N GST_N_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: BAM86745
UniProt: M4ZKG4
LinkDB All DBs
Position
complement(813164..813778)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALLEAGLPYDLVKVDLRAKTLENGDDYLKVNPKGQVPALGLPSG
EIVTEGPVIVQMIADQAADKNLAPPRDSGERYKLLEWLNFITSELHKNFSPMFQPALTDE
TKGFFKERLMGKFKYIDGQLAGRDYLLGKAFSVADGYLFTMLSWAERMKFDLSALPNLLA
YKARVAARPKVQEALTKEGLMKAG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattattcacccggcgcctgctcgctctcaccccacatcgccctgctcgaa
gccgggctgccctatgacctggtcaaggtcgatctgcgtgccaagactctggaaaatggc
gacgattatctcaaggtcaatccgaagggccaagtgccggcgctagggctgccgagcggc
gaaatcgtgacggagggcccggtgatcgtgcagatgatcgccgaccaggccgcggacaag
aacctcgccccgccgcgcgacagcggcgagcgctacaagctcctggagtggctgaatttc
atcacgtcggagctgcacaagaatttcagcccgatgttccagccggccctcaccgacgag
accaagggcttcttcaaggagcggctgatgggcaagttcaaatatatcgacggccagctg
gcgggccgcgactatctgctcggcaaggcattcagcgtcgccgacggctatttgttcacg
atgctgtcatgggcggagcggatgaaattcgacctctcggcgctgccgaacctgctcgcc
tacaaggcccgcgtcgcagcccggccgaaggtgcaggaggcgctgaccaaggaaggactg
atgaaggcggggtga

DBGET integrated database retrieval system