KEGG   Bradyrhizobium oligotrophicum: S58_11170Help
Entry
S58_11170         CDS       T02484                                 

Definition
(GenBank) ribonuclease BN-like family transmembrane protein
  KO
K07058  membrane protein
Organism
aol  Bradyrhizobium oligotrophicum
Brite
KEGG Orthology (KO) [BR:aol00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    S58_11170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BAM87127
UniProt: M4Z307
LinkDB All DBs
Position
complement(1288473..1289378)
Genome map
AA seq 301 aa AA seqDB search
MQEQVKALRYIFHVVMDAFYTFLADDGWAIASHIALSTLMALFPFLIVLTSLAGFLGSKD
LADQAATLMLETWPAQVADALTGEIHDVLTTTRTDALTIGAVLAVYFASNGVEALRVALN
RAYGVIEQRRWYWLRLESIGYTLVAAITALAMSFLIVLGPLMLATARRYLPLAVEANERF
VNLSRYGITISALIVALFILHAWLPAGRRSFMQIMPGIVFTFIASLVSGIVFGQYLARFA
YNYVTMYAGLASVIIALVFLYFIAAIFVYGGELNASIIKSRLPRGVSLQEAQSLEPAARR
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaacaggtgaaggcgcttcgctacatcttccacgtcgtcatggacgcgttctac
acattcctcgccgatgacggctgggcgatcgccagccatatcgcgctgtcgaccctgatg
gcgctgttcccgttcctgatcgtgctgacctcgcttgccggctttctcggctccaaggac
ctggccgaccaggccgccaccctgatgctcgagacttggccggcccaggtggcggacgcg
ctgaccggagagatccacgacgtgctgaccacgacccggaccgatgcgctgaccatcggc
gccgtgctcgcggtctacttcgcctccaacggcgtcgaggcgctgcgggtggcgctcaac
cgcgcctatggcgtgatcgagcagcgccgctggtactggctgcggctggaatcgatcggc
tataccctggtggccgcgatcacggcgctggcgatgtcgttcctgatcgtgctcgggccg
ctgatgctggccaccgcccggcgctatctgccgctggcggtcgaagccaacgagcgcttc
gtcaacctgtcgcgctacggcatcaccatcagcgccctgatcgtcgcgctgttcatcctg
cacgcctggctgccggccgggcggcgcagcttcatgcagatcatgcccggcatcgtcttc
accttcatcgcgtcgctggtgtcgggcatcgtgttcggccagtatctggcgcgcttcgcc
tacaactacgtgaccatgtatgcaggtctcgcatcggtgatcatcgcgctggtgttcctg
tatttcatcgccgcgatcttcgtctatggcggcgaactgaacgcatcgatcatcaagtcg
cggctgccgcgcggtgtgtcgctgcaagaagcgcagtcgctagagcccgcggcgagacgg
gcttga

DBGET integrated database retrieval system