KEGG   Bradyrhizobium oligotrophicum: S58_12330Help
Entry
S58_12330         CDS       T02484                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00030  Pentose phosphate pathway
aol00710  Carbon fixation in photosynthetic organisms
aol01100  Metabolic pathways
aol01110  Biosynthesis of secondary metabolites
aol01120  Microbial metabolism in diverse environments
aol01130  Biosynthesis of antibiotics
aol01200  Carbon metabolism
aol01230  Biosynthesis of amino acids
Module
aol_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
aol_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aol_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
aol_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    S58_12330
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    S58_12330
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    S58_12330
Enzymes [BR:aol01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     S58_12330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAM87243
UniProt: M4Z239
LinkDB All DBs
Position
complement(1412968..1414953)
Genome map
AA seq 661 aa AA seqDB search
MTQVDHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLFTRFLKYDAAAPAWPDRD
RFVLSAGHGSMLLYALLYLTGNEVMTLDQIKRFRQVDSLTPGHPENFRTKGIETTTGPLG
QGISTAVGMALAEKMLQAEYGKKTVDHHTYVLASDGDLMEGISQEAIAMAGHWKLNKLIV
LWDDNGISIDGPLSIADSVDQVKRFKACGWAAELIDGHDPEAIAAAITRAQKSSKPSLIA
CKTTIGYGAPTKAGTSKVHGEALGAEELKGAKEKLGISQEAFSVPDDVLAAWREAGRRGA
PARTEWETRLGEMGPRKRADFERRLRHERPPALAKALKDHKKALLESPLNVATRKSSEAA
IEVIAAAMPFEFVAGSADLTGSNNNKAKSATSFSAKTPKGRFIHYGIREHGMAAAMNGIF
LHGGFAPNGATFLVFSDYARGAMRLSALMGAGVVYVLTHDSIGLGEDGPTHQPVEHLAAL
RAIPNMRVFRPCDAVETAECWELALNRTNGPTVLALTRQNLPQLRTNAPADNPCSHGGYE
LVAAQGEAKVSLFATGSEVEIAVAAQKQLAERGIAARVVSVPSLELLLEQPAETKAKIIG
NAPVKIAIEAAVRWGWDAVIGQDGIFVGMHSFGESGPAKELYKHFGITAEAAVDAAVKRL
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggtcgatcattcccgcatggccaatgccatccgcgcgctcgcaatggatgcc
gtcgagaaggccaaatcgggccatcccggcctgccgatgggcgccgccgacgtcgccacc
gtgctgttcacccgcttcctgaaatatgatgctgcagcgcccgcctggccggaccgcgac
cgcttcgtgctgtcggcgggacacggctcgatgctgctctacgcgctgctgtatctgacc
ggcaacgaggtgatgacgctcgaccagatcaagcgcttccgccaggtcgattcgctgacc
ccggggcatccggaaaatttccgtaccaagggaatcgagaccacgaccggcccgctcggc
cagggcatctcgaccgcggttggcatggcgctcgccgaaaagatgctgcaggccgaatac
ggcaagaagaccgtcgatcatcacacctacgtgctggcctcggacggcgacctgatggag
ggcatctcccaggaagcgatcgcgatggccgggcactggaagctcaacaagctgatcgtg
ctgtgggacgacaacggcatctcgatcgacggcccgctgtcgatcgccgattcggtcgac
caggtgaagcgcttcaaggcgtgcggctgggcggccgagctgatcgacggccatgacccc
gaggcgattgcggcggcgatcacccgagcgcagaaatcctccaagccgagcctgatcgcc
tgcaagaccacgatcggctatggtgcgccgaccaaggccggcacctcgaaggtgcatggc
gaggcgctcggggccgaggaattgaagggcgccaaggagaagctcggcatttcgcaggaa
gccttctcggtgcccgacgacgtgctcgcagcctggcgcgaggccggccgccgcggcgcc
ccggcgcggaccgaatgggagacgcggctcggcgagatgggcccgcgcaagcgtgcggat
ttcgagcgccggctgcgccacgagcgcccgccggcgctggcaaaggcactgaaggaccac
aagaaggcgctgctggagagcccgctcaacgtcgccacccgcaaatcgtcggaggccgcg
atcgaggtgattgccgcggcgatgccgttcgagttcgtcgcaggctccgccgacctcacc
ggctccaacaacaacaaggcgaagtcggccacttcgttctcggccaagacgccgaagggc
cgcttcatccattacggcatccgcgagcacggcatggcggcggcgatgaacggcatcttc
ctgcatggcggcttcgcaccgaacggcgccaccttcctggtgttctccgactatgcccgc
ggcgccatgcgcctgtcggcgctgatgggcgccggcgtcgtctacgtgctgacacacgac
tccatcggcctcggcgaggacggcccgacgcatcagccggtcgaacatctcgccgcgctg
cgcgcgatcccgaacatgcgcgtgttccggccgtgcgacgcggtcgagaccgccgaatgc
tgggagctggcgctcaaccgcaccaacggcccgaccgtgctggcgctgacgcggcagaac
ctgccgcaactgcgcaccaacgcgcccgccgacaatccctgcagccatggcggctatgag
ctggtcgcagcgcagggcgaggccaaggtgtcgctgttcgccaccggctccgaggtcgag
atcgcggtggccgcgcagaagcagctcgccgagcgcggcattgccgcgcgcgtcgtctcg
gtgccgtcgctggagctgctgctggagcagccggccgagaccaaggccaagatcatcggc
aacgcgccggtcaagatcgccatcgaggccgcggtgcgctggggctgggacgccgtgatc
ggccaggacggcatcttcgtcggcatgcattcgttcggcgagagcggcccggccaaggag
ctgtacaagcatttcggcatcaccgccgaggccgcggtggacgcggccgtcaagcggctg
ggctga

DBGET integrated database retrieval system