KEGG   Bradyrhizobium oligotrophicum: S58_15070Help
Entry
S58_15070         CDS       T02484                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00010  Glycolysis / Gluconeogenesis
aol00620  Pyruvate metabolism
aol01100  Metabolic pathways
aol01110  Biosynthesis of secondary metabolites
aol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S58_15070
   00620 Pyruvate metabolism
    S58_15070
Enzymes [BR:aol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     S58_15070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAM87515
UniProt: M4ZMQ8
LinkDB All DBs
Position
1746293..1747810
Genome map
AA seq 505 aa AA seqDB search
MTKVDVNAALKPPFAARYDNFIGGAWKAPNAGKYFDNISPITGQPVCQIARSDASDIEGA
LDAAHAAKDGWARTSVTERAMVLNRIADRMEANLDKLALAETWDNGKPIRETTAADIPLA
IDHFRYFAGVIRAQEGSIAEIDHDTIAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAA
GNCVVLKPAEQTPASILVLMEIVGDLLPPGVLNVVNGFGLEAGKPLASSNRIAKIAFTGE
TSTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVCAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIHESIYEQFMERALQRVGAIVQGSPLDPATMIGAQASSEQMSKILSYIDIGKN
EGAQLLIGGERNVLGGDLAGGYYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKTEDEALA
IANDTLYGLGAGVWSRDANTCYRFGRHIQAGRVWTNCYHAYPAHAAFGGYKQSGVGRETH
KVMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggttgacgtcaatgcggcgctcaagccgccgttcgctgcgcgttacgacaac
ttcatcggcggcgcctggaaggcccccaacgccggcaagtatttcgacaacatctcgccg
atcaccgggcagccggtgtgtcagatcgcgcgctccgatgcgtccgacatcgagggcgcg
ctcgacgccgcgcatgccgccaaggacggctgggcccgcaccagcgtgaccgagcgcgcg
atggttctcaaccggatcgccgaccgcatggaggccaatctcgacaagctcgcgctcgcc
gagacctgggacaatggcaagccgatccgcgagaccaccgcggccgacatcccgctcgcc
attgatcacttccgttattttgccggcgtgatccgcgcccaggaaggctcgatcgcggag
atcgaccacgacaccatcgcctatcacttccacgagccgctcggcgtcgtcggccagatc
attccctggaatttcccgatcctgatggcggcctggaagctcgcgcccgcgctcgccgcc
ggcaattgcgtcgtgctcaagccggccgagcagacgccggcctcgatcctggtgctgatg
gagatcgtcggcgacctgctgccgccgggcgtgctcaacgtcgtcaacggcttcgggctc
gaggccggcaagccgctggcatcgtccaaccgcatcgccaagatcgccttcaccggtgag
acttcgaccggccggctgatcatgcaatatgcctcgcagaacctgatcccggtgaccctc
gagctcggcggcaagtcgccgaacatcttcttcaaggacgtctgcgccgaggacgacgac
ttcctcgacaaggcgatcgaaggcttcgtgatgttcgcgctcaaccagggcgaggtctgc
acctgcccgagccgcgcgctcattcacgaatcgatctatgagcagttcatggagcgcgcc
ctccagcgcgtcggcgcgatcgtgcagggcagcccgctcgatccggcaacgatgatcggc
gcgcaggcgtcctcggagcagatgtccaagatcctgtcctacatcgacatcggcaagaac
gagggcgcgcaactcctgatcggcggtgagcgcaacgtgctcggcggcgacctcgccggc
ggctactacgtcaagccgacggtgttcaagggacacaacaagatgcgcgtgttccaggag
gagatcttcgggcctgtcgtgtcggtcacgaccttcaagaccgaggacgaggcgctggcg
atcgccaacgacacgctctacggcctcggcgccggcgtgtggagccgcgacgccaacacc
tgctaccgcttcggccgccatatccaggccgggcgcgtctggaccaactgctatcacgcg
tatccggcgcatgcggcgttcggcggctacaagcagtccggagtcggtcgtgagacccac
aaggtgatgctcgaccactaccagcagaccaagaacatgctggtcagctacagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system