KEGG   Bradyrhizobium oligotrophicum: S58_18030Help
Entry
S58_18030         CDS       T02484                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00500  Starch and sucrose metabolism
aol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S58_18030
Enzymes [BR:aol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     S58_18030
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     S58_18030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: BAM87810
UniProt: M4ZNL1
LinkDB All DBs
Position
complement(2069456..2072761)
Genome map
AA seq 1101 aa AA seqDB search
MNVMSSLDATDLVTTTDGDGLWYKDAIIYQLHVKAFADSNNDGVGDFAGLTDKLDYLQDL
GVTTLWLLPFYPSPGRDDGYDIADYGSINPDFGTMKDFKRFIQEAKRRGLRVITELVVNH
TSDQHHWFKRARRSPPGSSARNWYVWSDTDQKYQGTRIIFTDTEKSNWTWDPEAGQFYWH
RFFSHQPDLNFDNPRVVNAIIQVMKRWLDAGVDGFRLDAIPYLCERDGTNNENLPETHAI
IKRLRVELDNYAKDKLLLAEANQWPEDVQEYFGQGDECHMAYHFPLMPRIYMAIAQEDRF
PITDILRQTPDIPATCQWALFLRNHDELTLEMVTDVERDYLWSTYANDPRARINVGIRRR
LAPLMDNDRRKIELMNSLLLSFPGTPIIYYGDEIGMGDNIYLGDRNGVRTPMQWTPDRNG
GFSRADPARLYAPMIMDPVYGYEAVNVEAQSRSLSSLLNATKKLISVRKSTLAFGRGTMA
FIRPANRSVLAYVRQYKDEVILCVANLSRSAQATELDLSAFKDRIPVEMLGRSRFPAIGT
LPYMITLAPYGFYWFQLKEREKSEPVVQRAVPEFETLVVPLGSTWVSLARTRSLFERDVL
PDHLARTRWYPERSAEAIHPTLTAAIPFCDIGDNRPWLIFFKAAERQDALRYLLPMQIDW
VRFDRERYNPQAFAAVRQGAREGTLLDAATTPIFLALLLRNLGQSLIVEENGLRLEFLPT
SRFPDKPIRESEQVRIIETDRCSSKAVVNNEFFIKIYRELEAGSHPEVDVGRFLTEIVGF
ANVPPLLGSVEVMQDGGRWTIGSVHGFVENQGDGWTVSAAYLDRYIDDQRVFAASGDERQ
SEELLPYLRYMAQAGRRVGELHAALASRDDMAEFAPEPTTADALDHWIDRLRAQAGRIFA
VLSERRDHFKDHERALVDQVLAKRSDLSERLSNLIPHHVGGFDIRVHGDFHLGQMLIVKD
DVFIIDFDGDEEQPLAERQRKAPPARDIAGFLRSIDCSVGVALDRALRAGPDDHGRIAAA
LLDWRDRAIAAFLAGYRENRTQQRLWPDDPHTAEALLNFFMLEKALGALEYDLAHRPDWL
RVALGNLLRVLFVPAPASESS
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgatgtcgtctctggatgcgaccgacctcgtgacgacgaccgatggcgacggt
ctctggtacaaggatgcgatcatttaccagctgcacgtcaaagccttcgccgacagcaac
aatgacggtgtcggcgatttcgccggcctgaccgataagctcgattatctgcaggacctc
ggcgtcaccacgctgtggctgttgccgttctacccctcgcccgggcgcgacgacggctac
gacattgccgactacggcagcatcaatcccgatttcgggacgatgaaggatttcaagcgc
ttcatccaggaggccaagcggcgcggcctgcgggtgatcaccgagctcgtggtcaaccac
acctccgaccagcatcactggttcaagcgcgcccggcgcagcccgcccggctcaagcgcc
cgcaactggtatgtctggagcgataccgaccagaaatatcagggcacgcgaatcatcttc
accgataccgagaagtccaactggacctgggatccggaggccggccagttctactggcac
cgcttcttctcacaccagccggacctcaatttcgacaatccacgcgtggtcaacgccatc
atccaggtgatgaagcgctggctcgatgccggtgtcgacggcttccggctcgacgccatc
ccctatctgtgcgagcgcgacggcaccaacaacgagaacctccccgaaacgcatgcgatc
atcaagcgcctgcgcgtcgagctcgacaattacgccaaggacaagctgctgctggccgag
gccaatcaatggcccgaggacgtgcaggaatatttcggccagggcgacgaatgccacatg
gcctaccacttcccgctgatgccgcgcatctacatggcgatcgcgcaggaggaccgtttc
ccgatcaccgacatcctgcgccagacgcccgacattcccgcgacctgccagtgggcgctg
ttcctgcgcaaccatgacgagctgaccttggagatggtgaccgacgtcgagcgggattat
ctgtggtcgacctacgccaacgatccgcgcgcgcgcatcaatgtcggcatccgccggcgg
ctggcgcccctgatggacaatgaccggcgcaagatcgagctgatgaactcgctgttgttg
tcgttccccggcacgccgatcatctattacggcgacgagatcggcatgggcgacaacatc
tatctcggtgaccgcaacggcgtgcgcacgccgatgcaatggacgccggaccgcaacggc
ggcttctcccgcgccgacccggcgcggctttacgcgccgatgatcatggaccccgtctat
ggctacgaggccgtcaacgtcgaggcgcagtcgcgcagcctgtcgtcgctcttgaacgcg
accaagaagctgatctcggtgcgcaaatcgacgctggcctttgggcgcggcacgatggcc
ttcatccgtcccgccaaccggtccgtgctggcctatgtccggcaatacaaggatgaggtc
atcctctgcgtcgccaatctgtcgcgctccgcgcaggcgaccgagctcgatctctccgcg
ttcaaggaccgcattccggtcgagatgctggggcgctcgcgctttcccgcgattggcacg
ctgccatacatgatcacgctcgcgccttacggcttctactggttccagctcaaggagcgc
gagaaatccgagccggtggtccagcgcgccgttccggaattcgaaacgctggtggtgccg
ctcggctccacctgggtgtccctggcgcgcacacgcagcctgttcgagcgcgacgtgctg
cccgaccacctcgcgcgcacgcgctggtaccccgagcgctcggccgaggcgatccatccg
acgctcacggccgcgattccgttctgcgacatcggcgacaaccgcccctggctgatcttc
ttcaaggccgctgaacggcaggacgcgctacgctatctgctgccgatgcagatcgactgg
gttcgcttcgatcgcgagcgctacaatccgcaggcgtttgccgccgtgcgccagggcgcc
cgcgaaggcaccctgctcgatgcggcgaccactcccatcttcctcgcactgctgctgcgg
aatctcggtcaatcgctgatcgtggaggagaacggactgcgcctggaattcctcccgacg
tcgcgatttccggacaagccgatccgcgagtccgagcaggtccgcatcatcgaaaccgac
cgctgcagcagcaaggcggtggtcaacaatgaattcttcatcaagatctatcgcgagcta
gaggctggcagccaccccgaggtcgatgtcggtcgcttcctgaccgagatcgtgggcttt
gccaacgtgccgccgctgctcggcagcgtcgaggtgatgcaggacggcgggcgctggacc
atcggcagcgtccacggctttgtcgagaaccagggcgacggctggaccgtcagcgcggcc
tatctcgaccgctacatcgacgaccagcgcgtatttgccgcaagcggcgacgagcgccag
agcgaggagctgttgccctacctgcgctacatggcacaggccggacgacgggtcggcgag
ttgcatgcggcattggcgtcgcgcgacgacatggccgagttcgccccggagccgacgacg
gccgatgcgctcgaccattggatcgaccggctccgcgcccaggcaggccgtattttcgcc
gtcctgagcgagcgccgcgaccacttcaaggatcatgagcgagcactggtcgaccaggtg
ctcgccaagcgaagcgatctgtcggagcggctcagcaatctgatcccgcaccatgtcggc
ggcttcgacatccgcgtccatggcgacttccatctcggccagatgctgatcgtcaaggac
gacgtcttcatcatcgacttcgacggcgacgaggagcagccgctcgccgagcgccagcgc
aaggcgccgccggcccgcgacatcgccggattcctgcgctcgatcgattgctcggtcggc
gtcgccctcgatcgcgccctgcgcgccggccccgacgaccacggccggattgccgcggcg
ctgttggactggcgcgatcgggccatcgccgcctttttggcgggctatcgcgagaacagg
acccaacagcgcctctggcccgacgatccgcacaccgcagaggcgctccttaactttttc
atgctggaaaaagccctcggagcactcgaatatgacttggctcaccggccggactggcta
cgcgtcgcgctgggcaacctgcttcgcgtcctgttcgtgccagcacctgccagcgagtcc
tcatga

DBGET integrated database retrieval system