KEGG   Bradyrhizobium oligotrophicum: S58_30190Help
Entry
S58_30190         CDS       T02484                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
aol  Bradyrhizobium oligotrophicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_Crp_2 HTH_24 PadR HemN_C HTH_IclR HTH_29 Dimerisation2 GntR HxlR
Motif
Other DBs
NCBI-ProteinID: BAM89019
UniProt: M4Z6L0
LinkDB All DBs
Position
3427501..3427962
Genome map
AA seq 153 aa AA seqDB search
MSLDARRQLVTQLVESSRILRNYIDHRAKQRGTTRAQWVVLFRLRAHEGMSQVDLAEVLE
LQPISLVRLLDRLVEQGLLERRHDPRDRRANRLHLTEAGRQLVDDLDGLRDAIAGDVLRD
ISDDAVATSLATLQELKERIKTLSETKAAIALK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctggacgcgagacgtcagctcgtgacgcagcttgtcgaaagctcgcgcattctg
cgcaactatattgatcatcgtgccaaacagcgcggcaccacccgcgcgcaatgggtggtg
ttgtttcggctgcgcgcgcatgaggggatgtcacaggtcgatctcgcagaagtgctggaa
ttgcagccgatttcgctggtgcgtctgctcgacaggctggtggagcagggattgctggaa
cgccggcacgatcccagggatcgccgcgcgaatcgccttcatctcaccgaggccggacga
cagctcgtcgacgatctcgacggtctgcgcgatgcgatcgccggcgatgtcctgcgcgac
atctcggacgatgcggtagcgaccagcctggccacgctgcaggagctcaaggagcggatc
aagacgctgtccgagacgaaggccgcgatcgcgctcaaatag

DBGET integrated database retrieval system