KEGG   Bradyrhizobium oligotrophicum: S58_32560Help
Entry
S58_32560         CDS       T02484                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00970  Aminoacyl-tRNA biosynthesis
aol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aol00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    S58_32560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aol03029]
    S58_32560
Enzymes [BR:aol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     S58_32560
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     S58_32560
Mitochondrial biogenesis [BR:aol03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    S58_32560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAM89254
UniProt: M4Z727
LinkDB All DBs
Position
3715881..3717536
Genome map
AA seq 551 aa AA seqDB search
MDIYLDNMLTLAEDLLASVVLEELAPRGLTIQEIPVELRDRQCPIRLKVVLWGNLPLPPG
SSNQGKLIKGATGDWEVVIGMEIHAQVTSKSKLFSGASTAFGGDPNSHVSLVDVAMPGML
PVINEECVRQAVRTGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVTVE
LDGGRTATVGIERLHIEQDPGKMLHDQSPSLSYIDFNRCGVALMEIVSKPDIRDAEQAKA
YVTKLRSIMRYLGTCDGDMEKGSLRADVNVSVRKPGGPLGTRCEIKNINSISFIGQAVEA
EARRQIEIIEDGGVIEQETRRFDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQAFVD
ELKAALPELPDQKTARFIADLGLSPYDASVLVAERESAAFYESVLEALSDRGRDGKLAAN
WVINELFGRLNKEGRDIASSPVSAAQLAAIVALIGEGTISGKIAKDLFEIVWSEGGDPRE
LVESRGMKQVTDLGAIEKVVDEIIAANPDKVAQAIAKPQLVGWFVGQVMKSSGGKANPQA
VNDLLKSKLGI
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggacatctacctcgacaatatgctgacccttgcagaggacctgttggcgtccgttgtt
ttggaagagttagcgcccagaggacttacgattcaagagataccggtcgagctgagggat
cggcaatgtccaattcggctcaaggttgtcttgtgggggaacctcccgttaccgccgggg
agctccaaccaaggcaagctgatcaagggcgccaccggcgactgggaggtcgtgatcggc
atggagatccatgcccaggtgacctcgaaatcaaaactgttctccggcgcctcgaccgcg
ttcggcggcgaccccaacagccacgtctcgctggtcgatgtggcgatgccgggcatgctg
ccggtcatcaacgaggagtgcgtgcgccaggccgtgcgcaccgggctcggcctgaacgcc
aagatcaacctgcgctcggtgttcgaccgcaagaactatttctatcccgacctgccgcag
ggctaccagatcagccagtacaaggacccgatcgtgggcgagggcgaggtcacggtcgag
ctcgacggcggcaggaccgccactgtcggcatcgagcgcctgcacatcgagcaggatccg
gggaagatgctgcacgaccagtcgccgtcgctgtcctatatcgacttcaaccgctgcggc
gtggcgctgatggagatcgtctccaagcctgatatccgcgacgccgagcaggccaaggcg
tacgtgaccaagctgcggtcgatcatgcgctatctcggcacctgcgacggcgatatggaa
aagggatcgctgcgcgccgacgtcaacgtctccgtgcgcaagccgggcgggccgctcggc
acccgctgcgagatcaagaacatcaactccatcagcttcatcggccaggcggtcgaagcc
gaggcgcggcgccagatcgagatcatcgaggacggcggcgtgatcgagcaggaaacccgc
cggttcgatcccgacaagggcgagacgcgctcgatgcgctccaaggaggaggcgcacgac
taccgttacttcccggacccggacctgttgccgctcgagttctcgcaggctttcgtcgac
gagctgaaggcggcgctgccggagctgccggaccagaagacggcgcgcttcatcgccgat
ctcggcctctcgccctacgacgcctcggtgctggtggccgagcgcgagagcgccgcgttc
tatgaaagcgtgctggaggcgctgtccgaccgcggccgggacggcaagctcgccgccaac
tgggtgatcaacgagctgttcgggcggctcaacaaggaaggccgcgacatcgcgtcgtct
cccgtctcggccgctcagctggccgcgatcgtcgcgctgatcggcgagggcaccatctcc
ggcaagatcgccaaggacctgttcgagatcgtctggagcgagggcggcgatccgcgcgag
ctggtggaaagtcgcggcatgaagcaggtgaccgacctcggcgcgatcgagaaggtcgtc
gacgagatcatcgcggccaatccggacaaggtcgcgcaggccatcgcgaagccgcagctg
gtcggctggttcgtcggtcaggtgatgaagtcgtcgggcggcaaagccaatccgcaggcg
gtcaacgatctcctgaagagcaagctcggcatctga

DBGET integrated database retrieval system