KEGG   Bradyrhizobium oligotrophicum: S58_40780Help
Entry
S58_40780         CDS       T02484                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00250  Alanine, aspartate and glutamate metabolism
aol00280  Valine, leucine and isoleucine degradation
aol00410  beta-Alanine metabolism
aol00640  Propanoate metabolism
aol00650  Butanoate metabolism
aol01100  Metabolic pathways
aol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    S58_40780
   00650 Butanoate metabolism
    S58_40780
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    S58_40780
   00280 Valine, leucine and isoleucine degradation
    S58_40780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S58_40780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aol01007]
    S58_40780
Enzymes [BR:aol01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     S58_40780
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     S58_40780
Amino acid related enzymes [BR:aol01007]
 Aminotransferase (transaminase)
  Class III
   S58_40780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAM90064
UniProt: M4Z8V8
LinkDB All DBs
Position
complement(4646094..4647371)
Genome map
AA seq 425 aa AA seqDB search
MAANEELLARRHQAVVRGVSYATPLFADRAVNSEVWDVEGKRYVDFAGGIAVLNTGHCHP
HVVAAIRAQLDRFTHTCFQVLQYEPYVRLSERLNALAPISGPAKSILLTTGAEATENAIK
IARAATGRSGIIAFTGAFHGRTALANAMTGKVLPYKKPFGPPLPGIWHAPFPIAGSSVSV
EDTLSYINFIFKADIDASQVAAIIIEPVQGEGGFHQAPPELMRGLRRICDANGIVLIADE
VQTGFGRTGKMFAMEHYDVQPDLICVAKSLAGGMPLSGVIGRAAIMDAAEPGGLGGTYGG
NPLACAAALAVLDVFEQEKLLDRANAIGDRLRAAIARFSRANTLVPVSGPRGPGAMVAFD
ILKQRGSDEPDAEMTKRVTRVAHENGLILLSCGVTASTIRILVPLTASDEIVDEGLAILE
KCLAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaacgaggaactgctggcgcgacggcaccaagccgtcgtcaggggcgtgagc
tacgcgacgccgctatttgccgaccgggcagtcaacagcgaggtctgggacgtcgaaggc
aagcgctacgtcgacttcgccggcggcatcgccgtgctcaacaccggacattgccacccg
catgtggtggccgcgatccgcgcccagctcgaccgtttcacccacacctgcttccaggtg
ctgcaatacgagccttatgtgcgtttgagcgagcggctcaatgcgctggcgccgatctcg
ggcccggccaagtcgatcctgctgacgacaggcgccgaggcgaccgagaacgccatcaag
atcgcgcgcgccgccacgggccgcagcggcatcatcgccttcaccggcgccttccatggc
cgcaccgcgctcgccaacgcgatgacgggcaaggtgctgccctacaagaagcccttcggg
ccgccgctgccgggcatctggcatgcgccgttcccgatcgccggtagcagcgtctctgtc
gaggacacgctgtcctacatcaatttcatcttcaaggccgacatcgacgcctcgcaggtc
gccgccatcatcatcgagccggtgcagggtgagggcggcttccaccaggcgccgccggag
ctgatgcggggcttgcgccggatctgcgacgccaacggcatcgtgctgatcgcggacgag
gtgcagaccggcttcggccgcaccggcaagatgttcgcgatggagcattacgacgtccag
cccgacctgatctgcgtcgccaagagcctcgccggcggcatgccgctgtcgggcgtgatc
gggcgcgcggcgatcatggacgcggccgagccgggcggcctcggcggcacctatggcggc
aatccgctggcctgcgcggcggcgctggccgtgctcgacgtgttcgagcaggagaagctg
ctcgaccgtgccaacgcgatcggtgaccgattgcgggcggcgatcgcgcgcttctcgcgc
gccaacacgctggttccggtttccggtccgcgcggtcctggcgcgatggttgcattcgat
atcctgaagcagcgcggcagcgacgagccggatgccgagatgacgaagcgcgtgactcgt
gtggcgcacgagaatggtctcatcctgttgtcctgcggcgtcacggcgagcaccatccgc
attctggtgccgctgaccgcgtctgacgagatcgtggacgaagggctcgcgatcctggag
aagtgtctggccgcctga

DBGET integrated database retrieval system