KEGG   Bradyrhizobium oligotrophicum: S58_47990Help
Entry
S58_47990         CDS       T02484                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00473  D-Alanine metabolism
aol00550  Peptidoglycan biosynthesis
aol01100  Metabolic pathways
aol01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    S58_47990
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    S58_47990
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    S58_47990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aol01011]
    S58_47990
Enzymes [BR:aol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     S58_47990
Peptidoglycan biosynthesis and degradation proteins [BR:aol01011]
 Precursor biosynthesis
  Amino acid ligase
   S58_47990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAM90778
UniProt: M4ZA82
LinkDB All DBs
Position
5432708..5433814
Genome map
AA seq 368 aa AA seqDB search
MMTEKTTRVAILFGGRSAEHDVSRASAANIFRSLDASRYAITLIGITSDGRWVLADAAND
GTATALTVPADGPQIVLLPAGQGRALVIGDGTAGTRDLVFDVVFPVLHGPNGEDGTVQGA
LELADVAYVGGRVLGSAAAMDKDVAKRLLRDAGLPIVPFVTMTEAAPVTYQDAVHAVGSS
ELFVKPANLGSSVGISKARNEAEFDAACRLALRFDRKILIERCITPVREIECAVLEHADG
KVAASELGEIVPADSHGFYSYEAKYTDASGASLHVPAQLEPALSERIRKLATEVFGVLCC
ESLARVDFFVRGDEVYVNEVNTLPGFTNISMYPKMWEATGLPQPALMDRLIAHALARHAR
LRQLASQR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagaaaagacaacgcgcgtggcgatcctgttcggcgggcgctcggcggagcat
gacgtgtcccgggcctccgccgccaacatcttccgttcgctcgacgccagccgctacgcc
atcaccttgatcggcatcaccagcgacggccgctgggtgctcgccgacgctgcgaatgac
ggcaccgccacggcgttgaccgtgcctgccgacggcccccagatcgtgctgctgccggcc
ggccagggccgcgcgctggtcatcggcgatggcacagccggcacgcgcgacctcgtcttc
gacgtcgtcttcccggtgctgcatggcccgaacggcgaggatggcaccgtgcagggcgcg
ctggagctggccgacgtcgcctatgtcggcggccgcgtgttgggatcggcggcggcgatg
gacaaggacgtcgccaagcggctgctgcgcgatgccggcctgccgatcgtgccgttcgtc
acgatgacggaagcagcgccggtcacctatcaggatgcggttcacgccgtcggatcatcc
gagctgttcgtcaagccggccaatctcggctcatcggtcggcatctccaaggcgcgcaac
gaagcggagttcgacgccgcctgtcgcctcgcgctgcgcttcgaccgaaagatcctgatc
gagcgctgcatcacgccggtgcgcgagatcgagtgcgccgtgctcgagcacgccgacggc
aaggttgcggcctccgagctcggcgagatcgtgccggccgacagccatggcttctactcc
tacgaggcgaagtacaccgacgcatcgggcgcctcgctccacgtcccggcgcagctcgag
ccggcgctttccgagcgcatccgcaagctcgcgaccgaggtgttcggcgtgctctgctgc
gagagtctcgcacgggtcgatttcttcgtccgcggcgacgaggtctacgtgaacgaggtc
aacacgctgcccggcttcaccaacatcagcatgtatccgaaaatgtgggaagccaccggc
ctgccccagcccgcgctgatggaccgcctcatcgcgcatgcgctggcgcggcatgcccgg
ctgaggcagctggcgtcgcagcggtga

DBGET integrated database retrieval system