KEGG   Bradyrhizobium oligotrophicum: S58_50320Help
Entry
S58_50320         CDS       T02484                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00620  Pyruvate metabolism
aol00680  Methane metabolism
aol00710  Carbon fixation in photosynthetic organisms
aol01100  Metabolic pathways
aol01120  Microbial metabolism in diverse environments
aol01200  Carbon metabolism
Module
aol_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    S58_50320
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    S58_50320
   00680 Methane metabolism
    S58_50320
Enzymes [BR:aol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     S58_50320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAM91011
UniProt: M4ZC32
LinkDB All DBs
Position
complement(5694550..5697336)
Genome map
AA seq 928 aa AA seqDB search
MSPQIMPSEDTRPNRAAEAQAMEEDARLRDDIRLLGRILGDTVRDQEGADVFDLVERIRQ
TSVRFHRDEDRQARHELEHILDGMTTAETVRIVRAFSYFSHLANIAEDQNNIRRMRAKSD
ANGGAGMLASTLAHAKSAGFEAADLRKFFSTALVSPVLTAHPTEVRRKSTMDREMEVAML
LDRRERMQLTPDEREANDEALRRAVLTLWQTNLLRRTKLTVLDEVTNGLSFYDYTFLREV
PRLLCALEDRLNDGAEVAGDLASFLRMGSWIGGDRDGNPFVTAEVMRGTLKLQSSLALHY
YLEELHLLGGELSMAAHLADVSEELRALAERSPDTSPHRIGEPYRLAVSGIYARLAATAK
KLGIQISRLPVGAVAPYDSVKEFQDDLDVLHRSLIANNAEVIARGRLRLLRRAIDCFGFH
LARLDIRQNSAVHERTVAELIDTAMPGMSYLALSEDARVGLLVSELRNTRPLVSQFIKYS
DETVGELALFRAAADAHATFGADVISQCIISMCKGMSDMLEVALLLKEVGLIDPSGRCGV
NIVPLFETIEDLQASSGIMDRMLALHDYRRLVDSRGAVQEVMLGYSDSNKDGGFVTSGWE
LYKAEIGLVDIFERHGVRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITEQGEI
ISSKYSNAEVGRNNLDILAAATLEASLLHPRQPAPKREYLTAMDRLSELAFKAYRGLVYE
TDGFVEYFWSSTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLPGWYGF
GSAVESWIAENPEQGMPFLRELYREWPFFRMLLSNMDMVLAKSSIAIASRYAELVPDEAL
REKIFGRIRREWNLVIETLLDIMGQERLLQGNPLLERSVRNRFPYLDPLNHVQVELLKEH
RAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgcaaatcatgccatccgaggatacacgacccaatcgcgctgctgaagcgcag
gcgatggaggaggatgcgaggctccgggatgacatccggctgctcggccgaatcctcggc
gacaccgtccgcgaccaggagggcgccgatgtgttcgacctcgtcgagcgcatccgccag
acctcggtgcgtttccatcgcgacgaagatcgccaggcgcggcatgagctggagcacatc
ctcgacggcatgacgaccgcggagacagtccgcatcgtccgcgccttcagctatttttcg
cacctcgccaacatcgccgaggaccagaacaacatccgccgcatgcgcgccaagagcgac
gccaatggcggcgccggcatgctggcctcgacgctggcccacgccaagtcggcgggattc
gaggcggccgacctgcgcaagttcttctccaccgcgctggtcagtcccgtcctcaccgcg
catccgaccgaggtgcggcgcaagagcacgatggaccgcgagatggaggtcgcgatgctg
ctcgaccgccgcgagcggatgcagctcacgccggacgagcgcgaggccaatgacgaggcg
ctgcgccgcgccgtgctgaccctgtggcagaccaacctgctgcgccggaccaagctgacc
gtgctcgacgaggtcaccaacggcctgtcgttctacgactacacgttcctgcgcgaggtg
cctcggctgctgtgcgcgctggaggaccgcctgaacgacggcgccgaggttgcgggtgac
ctcgcctccttcctgcgcatgggcagctggatcggcggcgaccgcgacggcaatccgttc
gtcaccgccgaggtgatgcgtggaacgctcaagctgcaatccagcctcgcgctgcattac
tacctcgaagagctgcatctgctcggcggcgaattgtccatggcggcccatctcgccgac
gtgtcggaagaactgcgcgcgctggccgaacgctcgcccgacacttcgccgcatcgtatc
ggggagccgtatcgtctggccgtgtccggcatctatgcccggctggcggcgactgcgaag
aagctcggcatccagatcagccgcctgccggtgggggcggtcgcgccctatgacagcgtc
aaggagttccaggacgatctcgacgtgctgcatcgctcgctgatcgccaacaatgccgag
gtgatcgcgcgcgggcggctgcggctgctgcggcgcgccattgattgtttcggctttcac
ctggcgcggctcgacatccggcagaactcggccgtgcacgagcgcacggtcgccgagctg
atcgatacggcgatgcccggaatgtcctatctcgcgctcagcgaggatgcgcgggtcggc
ctgctcgtcagcgagctgcgcaacacgcggccgctggtgtcgcaattcatcaagtacagc
gacgagacggtcggtgagctcgcgctgttccgcgccgccgccgacgcgcacgccaccttc
ggcgccgacgtgatttcccaatgcatcatctcgatgtgcaagggcatgtccgacatgctc
gaggtcgcgctgctcctgaaggaggtcggactgatcgatccctccggccgctgcggcgtc
aacatcgtgccgctgttcgagaccatcgaggatctgcaggcctccagcggcatcatggac
cggatgctggcgctgcacgattatcgccgcctggtcgacagccgcggtgccgtgcaggag
gtcatgctcggctactccgacagcaacaaggacggtggcttcgtcacctcgggctgggag
ctctacaaggccgagatcgggctggtcgacatcttcgagcgccatggcgtgcggctgcgt
ctgttccacggccgcggcggctcggtcggccgcggcggcggcccgagctacgacgccatc
atcgcccagcccggcggcgccgtgaacggccagatccgcatcaccgagcagggcgagatc
atctccagcaaatattccaacgcggaggtcgggcgcaacaacctggatattcttgctgcg
gcgaccttggaagcgagcctgctgcatccgcgccagccggcgccgaagcgcgaatacctc
accgcgatggaccggctctccgagctcgctttcaaggcctatcgcggcctggtctacgag
accgatggcttcgtcgagtatttctggtcctccaccgtcatcaacgagatcgccacgctc
aacatcggcagccgtccggcgtcgcgcaagaagacccgtgcgatcgaggatctgcgcgcc
attccctgggtgttctcctgggcgcagtgccggctgatgctgccgggctggtacggcttc
ggcagcgcggtggaaagttggatcgcggaaaatccggagcagggcatgccgttcctgcgc
gagctgtatcgcgaatggccgttcttccgcatgctgctgtcgaacatggacatggtgctg
gccaagagctcgatcgccatcgcctcgcgctatgccgagctggtgccggatgaagcgttg
cgggaaaagattttcggccgtatccgccgcgaatggaatctggtgatcgagacgctgctc
gacatcatgggccaggagcgattgctgcagggcaacccgctgctggagcgctcggtgcgc
aaccgctttccctatctcgatccgctcaaccatgtgcaggtcgagcttctgaaggagcat
cgcgcgcagaacccggacgagcaggttttgcgcgggattcagctgacgatcaacggcatc
tcggcggggctgaggaatacggggtag

DBGET integrated database retrieval system