KEGG   Bradyrhizobium oligotrophicum: S58_51410Help
Entry
S58_51410         CDS       T02484                                 

Definition
(GenBank) nitrate transport permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00910  Nitrogen metabolism
aol02010  ABC transporters
Module
aol_M00438  Nitrate/nitrite transport system
aol_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    S58_51410
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    S58_51410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aol02000]
    S58_51410
Transporters [BR:aol02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    S58_51410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAM91120
UniProt: M4ZXL0
LinkDB All DBs
Position
complement(5826396..5827313)
Genome map
AA seq 305 aa AA seqDB search
MSMPALTNDRAPNVVPTASTSASVTSASVVTMTPKQPPRAERYVKMAREVAVRVVPPLIV
LALFLIVWELLCRRAGSALPPPSRVFMDTRELILDPFFDHGGIDKGLFWHLEASLRRVAI
GYAIAAIVGVAVGTLIGQSVWAMRGLDPIFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVI
FITSVWPIIINTAVGIRNIPQDYRNVAAVVQLNPLEFFAKIMIPAAAPYIFTGLRIGIGL
SWLAIVAAEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIIGFVLDRLIAFVGKVVTR
GTATN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgccagcgttgaccaatgatcgcgcccccaacgtcgtgccgacggcgtccacg
tctgcgtccgtcacgtctgcgtccgtcgtgacgatgacgccgaagcagccgccgcgtgcc
gagcgctatgtgaagatggcccgcgaggtcgcggtacgcgtcgtgccgccgctgatcgtg
ctggcgctgttcctgatcgtctgggagctgctctgccgccgcgccggctcggcgctgccg
ccgccgtcgcgcgtgttcatggacacccgcgagttgatcctcgatccgttcttcgaccat
ggcggcatcgacaaggggctgttctggcacctggaggccagcctgcgccgtgtcgcgatc
ggctacgcgatcgccgcaatcgtcggcgtcgcggtcggcaccttgatcggccagtcggtg
tgggcgatgcgcggtctcgatccgatcttccaggtgctgcgcacgatcccgccgctggcc
tggctgccgctgtcgctcgccgcgttccgcgacggccagccgtcggcgatcttcgtgatc
ttcatcacctcggtgtggccgatcatcatcaacaccgccgtcggcatccgtaacatcccg
caggactaccgcaacgttgcggctgtcgtgcagctcaatccgctggagttcttcgccaag
atcatgatcccggcggccgcgccctacatcttcacgggcctgcgcatcggcatcggcctg
tcatggctcgcgatcgtcgcggccgagatgctgatcggcggcgtcggcatcggcttcttc
atctgggatgcgtggaattcctcgcatatcagcgagatcatcctggcgctgttctatgtc
ggcatcatcggcttcgtgctcgaccgcctgattgccttcgttggcaaggtcgtcacccgc
ggcaccgcaacgaactga

DBGET integrated database retrieval system